KEGG   Vitis vinifera (wine grape): 100263819Help
Entry
100263819         CDS       T01084                                 

Definition
(RefSeq) NADH--cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100263819
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100263819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100263819
NCBI-ProteinID: XP_002274424
UniProt: D7TL34
Position
8
AA seq 277 aa AA seqDB search
MDFLEAPEIQILGVAVAAVAVVAGAAYFYSTRKPKGCLDPENFKQFKLVKRTQLSHNVAK
FRFDLPTPTSVLGLPIGQHISCKGKDGEGQEIIKPYTPTTLDSDVGYFELVIKMYPQGRM
SHHFREMRVGDYLAVKGPKGRFRYQVGQVRAFGMLAGGSGITPMFQVARAILENPKDKTK
VHLIYANVTFEDILLKEELEGLSASYPDHFKVYYVLNQPPEAWNGGVGFVSKEMIKAHCP
APASDIKILRCGPPPMNKAMAAILNDIGYTDEMQFQF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggacttcttggaagcgccagaaatccagattctgggtgtggctgtggctgctgtggca
gttgtggctggggctgcatatttctattccaccaggaaacccaaaggctgcctagaccct
gagaacttcaagcaattcaaacttgtcaagcgcacacagctcagccataatgtagcaaag
ttcagatttgatcttcctactcccacatcagtgttgggcctcccaattggacaacatata
agttgcaagggtaaggatggtgagggtcaagaaattatcaaaccatataccccaactaca
ttggattctgatgttggatattttgaacttgttataaagatgtatccacaaggaaggatg
tcacatcattttcgagagatgcgtgtaggtgattatctggctgtaaagggacccaagggg
cgtttcaggtatcaagttggccaagttagggcatttgggatgcttgctggaggttctgga
attacaccaatgttccaagttgctagagctatattagaaaacccaaaagacaaaacgaag
gtgcaccttatttatgctaacgttacatttgaggacattctcttgaaggaggaactggaa
ggcctttctgccagctaccctgatcactttaaagtttactatgttctgaatcagcctcct
gaagcatggaacggtggcgtcgggtttgtatccaaggaaatgatcaaggcccattgccct
gcacctgcatctgacattaagattctccgatgtggtccaccacccatgaacaaggccatg
gccgccatcctcaacgatattggatacacagatgagatgcagttccagttctaa

DBGET integrated database retrieval system