KEGG   Vitis vinifera (wine grape): 100263930Help
Entry
100263930         CDS       T01084                                 

Definition
serine/threonine-protein phosphatase PP1-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:vvi03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 297 aa AA seqDB search
MEGLDGLIERLLEARKCRGKRIQMSESEIRQLCITAKDVFLSQPNLLELEAPINVCGDIH
GQYSDLLRLFEYGGFPPDSNYLLLGDYVDRGKQSIETISLLLCYKIKYPDNFFLLRGNHE
CASINRIYGFYDECKRRFSVRLWKIFTDCFNCLPVAAIIENKILCMHGGLSPEIESLDQI
RAIERPVDVPDQGLLCDLLWADPDRDIKGWGENDRGVSYTFGADKVAEFLKKHDLDLICR
AHQVVEDGYEFFAERQLVTIFSAPNYCGEFNNAGALMSVDASLLCSFQILKPFKAKE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaagggttggatggtttgatagagaggctattggaagcaagaaaatgtagaggaaaa
agaatacagatgagcgagtctgagatccgccaactttgtattactgccaaggatgtcttc
ctcagccagcccaatctcttggaattagaagctcccattaatgtttgtggagacatacat
ggacagtactcagacctcctccggttattcgaatatgggggttttccccctgactccaac
tacctactcctgggagactacgtggatagaggaaaacaaagtatagagacaatatccctt
ctcctctgctacaagatcaagtaccctgataacttctttctcctccgaggaaaccatgaa
tgtgcttccatcaatagaatctacggcttctacgacgagtgcaagcgccgcttcagtgtc
cgcctgtggaagattttcaccgactgcttcaactgtttaccggtcgccgctatcatcgag
aacaaaatattgtgcatgcatggtgggctgtcgccggagatagagagcttggatcagata
agggccatagagaggccggtggatgtgccggaccaaggcctcttgtgtgatctgctgtgg
gctgatcctgacagagatatcaagggatggggggagaatgataggggtgtttcctatact
tttggagctgataaggtggccgaattcttgaagaagcatgatcttgatctcatatgtcga
gcccatcaggttgtggaagatggatacgaattctttgcagagaggcagctggtaacaata
ttctcagctccaaactactgtggagaattcaacaatgcaggggcactgatgagtgtagat
gcaagtttgctgtgctcatttcagattctcaaacccttcaaagcaaaggagtga

DBGET integrated database retrieval system