KEGG   Vitis vinifera (wine grape): 100263976Help
Entry
100263976         CDS       T01084                                 

Definition
mitogen-activated protein kinase 3-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    100263976
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100263976
Protein kinases [BR:vvi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100263976
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100263976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 375 aa AA seqDB search
MADNTRNSTGGQLSDFPAVPTHGGLFFQHNIFGNLFEITAKYRPPIMPIGRGAYGIVCSV
LNSETNEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENVIGIRDVVPPPLRREFSDV
YIATELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNAN
CDLKICDFGLARPTAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR
RPLFAGKDHVHQMRLLTELLGTPTESDLGFVRNDDARRYIMQLPQHPRQPLVNVFPHIHP
LAIDLIDRMLTFDPTKRITVEEALAHPYLSRLHDTADEPVCPEPFSFEFEQQALVEEQMK
DMIYQEALFFNPGYA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatacgaggaactccaccggcggtcaattaagtgattttccggctgttccg
acacatggaggtctgtttttccaacacaacatcttcggaaatctctttgagatcacagcg
aagtaccggcctccgatcatgccgatcggtcgtggcgcatacgggatcgtctgctcggtg
ttgaattcggagacgaatgaaatggtagcaatcaagaaaatagcgaacgccttcgataat
cacatggatgcgaagcgtacgcttcgggagattaaacttcttagacatttggatcacgaa
aacgttataggtataagagatgtagtccctcctcctttaaggagagaattttctgatgtc
tacattgccacggaactcatggacactgatctgcaccaaataattcgctccaaccaaggt
ttatcagaggagcactgtcaatacttcttgtaccagatacttcgtggactgaaatatata
cactccgcaaatgtgattcatagagatttgaagcccagcaacctcttgctgaatgcaaat
tgtgatctaaaaatttgtgattttggtcttgctcgtccaactgcagagaatgagttcatg
acggaatatgttgttacgagatggtacagggcacctgaactactgctgaattcttcagat
tacactgctgcaattgatgtctggtctgtgggttgcatttttatggagcttatgaacaga
aggcctttatttgcgggtaaagaccatgtgcatcaaatgcgcttattgacagagcttctt
ggcacacccactgagtctgatcttgggtttgttcggaatgatgatgcaagaagatatatc
atgcaactcccccaacatccccgccagccattagtaaacgttttcccacatattcatcca
ctggccattgatctcattgatagaatgttgacatttgatccgactaaaagaattactgtt
gaagaagcattagcccatccttacctttcaagattacatgatacagctgatgaaccagtt
tgcccagagccattttcctttgaatttgagcaacaagctctggtagaagaacagatgaag
gatatgatttaccaggaggctttatttttcaatccaggttacgcttaa

DBGET integrated database retrieval system