KEGG   Vitis vinifera (wine grape): 100263976Help
Entry
100263976         CDS       T01084                                 

Definition
mitogen-activated protein kinase 3-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:vvi04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 375 aa AA seqDB search
MADNTRNSTGGQLSDFPAVPTHGGLFFQHNIFGNLFEITAKYRPPIMPIGRGAYGIVCSV
LNSETNEMVAIKKIANAFDNHMDAKRTLREIKLLRHLDHENVIGIRDVVPPPLRREFSDV
YIATELMDTDLHQIIRSNQGLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNAN
CDLKICDFGLARPTAENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNR
RPLFAGKDHVHQMRLLTELLGTPTESDLGFVRNDDARRYIMQLPQHPRQPLVNVFPHIHP
LAIDLIDRMLTFDPTKRITVEEALAHPYLSRLHDTADEPVCPEPFSFEFEQQALVEEQMK
DMIYQEALFFNPGYA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatacgaggaactccaccggcggtcaattaagtgattttccggctgttccg
acacatggaggtctgtttttccaacacaacatcttcggaaatctctttgagatcacagcg
aagtaccggcctccgatcatgccgatcggtcgtggcgcatacgggatcgtctgctcggtg
ttgaattcggagacgaatgaaatggtagcaatcaagaaaatagcgaacgccttcgataat
cacatggatgcgaagcgtacgcttcgggagattaaacttcttagacatttggatcacgaa
aacgttataggtataagagatgtagtccctcctcctttaaggagagaattttctgatgtc
tacattgccacggaactcatggacactgatctgcaccaaataattcgctccaaccaaggt
ttatcagaggagcactgtcaatacttcttgtaccagatacttcgtggactgaaatatata
cactccgcaaatgtgattcatagagatttgaagcccagcaacctcttgctgaatgcaaat
tgtgatctaaaaatttgtgattttggtcttgctcgtccaactgcagagaatgagttcatg
acggaatatgttgttacgagatggtacagggcacctgaactactgctgaattcttcagat
tacactgctgcaattgatgtctggtctgtgggttgcatttttatggagcttatgaacaga
aggcctttatttgcgggtaaagaccatgtgcatcaaatgcgcttattgacagagcttctt
ggcacacccactgagtctgatcttgggtttgttcggaatgatgatgcaagaagatatatc
atgcaactcccccaacatccccgccagccattagtaaacgttttcccacatattcatcca
ctggccattgatctcattgatagaatgttgacatttgatccgactaaaagaattactgtt
gaagaagcattagcccatccttacctttcaagattacatgatacagctgatgaaccagtt
tgcccagagccattttcctttgaatttgagcaacaagctctggtagaagaacagatgaag
gatatgatttaccaggaggctttatttttcaatccaggttacgcttaa

DBGET integrated database retrieval system