KEGG   Vitis vinifera (wine grape): 100264052Help
Entry
100264052         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100264052
Peptidases [BR:vvi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100264052
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100264052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 794 aa AA seqDB search
MDLLRSNLSRVRIPEPTNRIYKQECCVSFATPKSEGGLFIDMSTFLAFGKDCVDWNYEKT
GNPVYLHIKQTKKLVPEDRPLKKPTLLAIGVDGGFDNNEPEYEEAHNIVILPSYVSLPFP
SVELPEKVRLAVDAILMAEGAERKEQLALWTADKKEISAYAMSLQQIDNGVIIPRSGWKC
SKCDKTENLWLNLTDGMILCGRKNWDGTGGNNHAIEHYKETGYPLAVKLGTITADLEGAD
VFSYPEDDSVLDPLLAQHLAFFGIDFSSLQKTEMTTAERELDQNTNFDWNRIQESGQEVE
PLFGPGYTGLVNLGNSCYLASTMQVVFSTQSFHSRYYLSQSLKAAFETAPADPTVDLNMQ
LTKLAHGMLSGKYSFPASEKQEGIPPRMFKAVIAASHPEFSSMRQQDALEFFLHLLDQVE
RVNAGHPELDPSRSFKFGIEERLFCPSGKVAYNRRGDYILSLNIPLHEATNKDQLEAFNK
LKAEKKAEGKEVSGDEIVRPRVPLEACLASFSAPEEVHGFYSTALKTKTTAVKTAGLTSF
PDYLVLHMRKFVMEEGWVPKKLDVYIDVPDIIDISHMRSRGIQPGEELLPEAVDEGKVES
EKLLANEEIVAQLVSMGFNHLHCQKAAINTSNAGVEEAMNWLLSHMDDPDIDFPISQEAE
NAEALSFVDQSKVDTLISFGFQEDISRRALRASGGDIEKATDWIFSNPDAASSSDMDATT
SSTPTADAGLPDGGGRYRLIGLVSHIGTSTQCGHYVAHIYKDGRWVIFNDDKVGASINPP
KDMGYLYFFERLSS
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggacctccttcgatccaacctctctcgtgtccgaattcctgagcccactaatcgcatc
tacaagcaagaatgctgcgtttcgtttgctactccgaaatccgaaggtggattgttcatt
gacatgagtacgtttcttgcgtttgggaaggactgtgtggactggaactatgagaagact
ggaaatcctgtttatttgcatataaagcagaccaagaaattagttcctgaagatcggcct
ttgaagaaaccgacacttttggctataggtgttgacgggggatttgacaataatgaacct
gaatatgaagaagctcataatatagtcatattgcctagttacgtatctcttccatttcca
tctgtggagttgccggagaaggtaaggttggcagttgatgccatcttaatggctgagggt
gctgagagaaaagagcaacttgccttgtggacagctgataagaaggaaatcagtgcttat
gccatgagtctgcagcagattgacaatggtgtcattattcctcgatcagggtggaaatgt
tccaagtgtgataaaactgagaatctttggttaaatttgactgatggaatgatcctttgt
gggaggaaaaattgggatggaactggtggcaacaaccatgccattgagcattacaaggag
acaggctaccctcttgctgtgaagcttggtacgataactgctgatctggaaggagcagat
gttttctcttatccggaggatgatagtgttttggacccccttctagcacagcatttggca
ttttttggtattgatttttcatcattacagaagactgaaatgactactgctgaaagggaa
cttgaccagaataccaattttgattggaaccgaattcaagaaagtggacaagaagttgaa
ccactatttggacctggctatacaggacttgtcaatcttggaaacagttgttacttggca
tcaaccatgcaagttgtgttctcaacacagtccttccattcacgatattacttgagccaa
agtttgaaagcagcttttgagactgctcctgctgatccaactgtagatctgaacatgcaa
ttgacaaaattggctcatggtatgctatctggtaaatactcatttccagcatcagagaaa
caagaaggcataccccctcgtatgttcaaggcagttattgctgccagccatcctgaattt
tctagtatgagacagcaggatgccttagaattctttctgcatttgcttgaccaagttgaa
cgagttaatgctgggcaccctgaattggatccctcaaggagcttcaagtttggtattgag
gagcgacttttttgtccatccggaaaggttgcttataatagaaggggggattatattctt
tctctaaatattccactgcatgaagctactaataaagatcagctagaagcctttaacaaa
ctgaaggcagaaaagaaagcagaggggaaagaagtatctggtgatgaaatcgttcgtcca
agggtgcctcttgaagcttgcctagcaagcttttcagctccagaggaggttcatggtttt
tacagcactgccttgaagactaaaacaaccgcagtcaagactgctggtctaacttcattt
cctgattatttggtgttgcacatgcggaaatttgttatggaggaaggctgggtgccaaaa
aagcttgatgtctacatagatgttcctgatatcattgatattagtcacatgcgtagcagg
ggcattcagcctggggaagagctattaccagaggctgttgatgagggtaaggtggagtca
gaaaagctcttggccaatgaggagatagttgctcaacttgtgtcaatgggatttaaccat
cttcattgccagaaagctgctattaacacgtctaatgctggagtggaagaggcgatgaat
tggttgctatcacacatggatgatccagatatagattttcccatttctcaagaggcagaa
aatgctgaggccttgtcatttgtggaccaatcaaaagttgatactctgatttcatttggt
tttcaggaagacatttctcggagggcattgagagcatcgggtggtgatattgagaaagca
actgattggatatttagcaatcctgatgctgctagttcatcagatatggatgctacaaca
agcagtactcctactgctgatgctggattgcctgatggaggaggaagataccgacttatt
gggctagtgagccacattggaacctcaacccagtgtggtcactatgttgctcatatatac
aaggatggaaggtgggttattttcaacgatgacaaggttggggcttctattaatcccccc
aaggatatgggatatttatatttctttgagagactgagcagttga

DBGET integrated database retrieval system