KEGG   Vitis vinifera (wine grape): 100264076Help
Entry
100264076         CDS       T01084                                 

Definition
PAP-specific phosphatase HAL2-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100264076
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100264076
Transfer RNA biogenesis [BR:vvi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100264076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 381 aa AA seqDB search
MDNAMYSEELAVAVRVVHMACCLCQRVQDGLVGTSSEQVKSKDDDSPVTVADWSVQATVS
WILAEVFGSQNVSIVAEEEIQTLSKPDSADLLEAVVNTVNECLSEAPKFGLKCPDKALRT
SQVLDAISRCNSTGGPKGRHWILDPVDGTLGFVRGDQYAVALALIEDGKVVIGVLGCPNY
PMNKEWLNYHNKFYQAMSKQSPPASDSWEKGCVMYARRGSGEAWMQPMVLGDQKLEWPNS
ARLIKVSSIDNPAMATFCEPVEKANSNHSFTKGLVHSVGLRKQPLRVYSMVKYAAIARGD
AEIFMKFARAGYKEKIWDHAAGVLIVEEAGGVVTDAGGRPLDFSRGIYLEGLDRGIIVCS
GAALHEKIIGAVYASWDSSNL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggataatgccatgtactcagaggaattggctgttgccgttagagttgtccatatggcg
tgttgtttgtgccagagagtgcaggatgggttggttgggacgagcagtgagcaggtgaag
tccaaggatgatgattcacctgttacagttgcagattggagtgtgcaagcaactgttagc
tggatattggcggaagtgtttggaagtcaaaatgtgtccattgttgcagaagaagagatc
caaactctttccaaacctgattcagccgatttattggaagcggtggtgaacacagttaat
gaatgcttatctgaagcacctaagtttggtctcaaatgcccagataaagccctcaggaca
tcacaagttcttgatgccatcagccgatgcaactcaactggagggcccaagggaaggcat
tggatacttgaccctgttgatggaacattagggtttgtacgaggggatcagtatgctgta
gctctagccttgattgaggatggaaaggttgtcattggagttcttggttgccctaattac
ccaatgaacaaggaatggctaaattaccacaataaattctaccaagctatgtcaaaacag
tccccacccgcttctgattcatgggagaagggatgtgttatgtatgcaaggagaggaagt
ggtgaagcatggatgcagccaatggtcctgggagatcagaagcttgagtggccaaactct
gcaagattgattaaagtttcttccattgacaatccagcaatggctactttttgtgaaccg
gtggagaaggcaaattcaaaccactccttcacaaagggacttgttcacagtgttgggctt
agaaagcagcctttgcgcgtctatagcatggtgaagtatgcagccatagcccggggagat
gctgagatttttatgaagtttgcaagagctggatacaaggagaagatatgggatcatgct
gctggtgtcctcattgtagaagaggctggtggtgtggtaactgatgctggagggcgtcca
ctggacttctcgaggggaatatacctagaaggtcttgatcggggcatcattgtttgctct
ggtgctgcactgcatgagaaaatcattggtgctgtttatgctagctgggactcttccaat
ctttga

DBGET integrated database retrieval system