KEGG   Vitis vinifera (wine grape): 100264166Help
Entry
100264166         CDS       T01084                                 

Definition
tryptophan synthase beta chain 2, chloroplastic-like
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100264166
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100264166
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100264166
Enzymes [BR:vvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100264166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 458 aa AA seqDB search
MAASAKTPISRTQTTSLYKPYSSSPQLPFKLLKLTPTPCAAKGLSICCALQMEPKVGPGS
QVPDSFGRFGKFGGKYVPETLMHALTELESAFRALSGDVEFQKELDGILKDYVGRESPLY
FAERLTEHYKRHNGEGPLIYLKREDLNHTGAHKINNAVAQALLAKRLGKTRIIAETGAGQ
HGVATATVCARFGLQCIVYMGAQDMERQALNVFRMRLLGAEVRAVHAGTATLKDATSEAI
RDWVTNVETTHYILGSVAGPHPYPMMVRDFHAVIGKETRKQAMEKWGGKPDVLVACVGGG
SNAMGLFYEFVDDEDVRLIGVEAAGFGLDSGKHAATLTRGEVGVLHGAMSYLLQDDDGQI
IEPHSISAGLDYPGVGPEHSFLKDLGRAEYHSITDEEALEAFKRLSRLEGIIPALETSHA
LAYLEKLCPTLPNGTKVVLNCSGRGDKDVHTAIKHLQV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctctgcaaaaaccccaatctccagaacccagaccacgtctctctataagccc
tacagcagttctccccaattgcccttcaaactcctcaagcttacacctaccccttgcgcc
gccaaagggctgtccatttgctgtgccctgcaaatggagcccaaggttggacctggttcg
caggtgccggattcgtttggccggttcgggaaattcggagggaagtacgttcccgaaact
ctgatgcatgccctcaccgagctggagtctgcattccgggctctctctggagacgtagaa
tttcagaaagaactagatggaatattgaaggactatgttggcagggagagccctctttat
tttgcagagcggcttacggagcactataagcgtcacaatggtgaagggccactcatttac
ctcaagagggaagatctgaaccatactggggctcacaagattaacaatgctgttgcccaa
gctctgcttgccaagcgtttgggaaaaacacgcattattgctgaaactggtgctggtcag
catggagttgcaactgcaactgtatgtgctcggtttggattgcagtgtattgtttatatg
ggtgcccaagatatggaaaggcaggcacttaatgttttcagaatgcggcttcttggggct
gaggttagagctgttcatgctgggacagctactctgaaagatgcaacatcagaagctata
cgagactgggtgactaatgtggagacaacccattatattttgggttctgttgctgggccc
catccttatcccatgatggtcagggacttccatgcagtgattggcaaagaaacaagaaaa
caggcaatggaaaagtggggaggcaaaccagatgtgctggttgcatgtgtaggtggaggt
tccaatgccatggggcttttttatgaatttgttgatgatgaagacgttaggctgattggt
gtggaggcagcaggttttggcttagatagcggtaaacacgctgctaccttgactagaggg
gaggttggggtcttgcatggcgcgatgagttatttattacaagatgatgatggacaaata
attgagcctcattctattagtgctggcctggattaccctggagttgggccagagcatagc
tttctgaaagatttaggacgtgctgaataccatagcatcactgatgaagaagcattggaa
gctttcaagagattatctcgacttgaaggcataatccctgctctggagacatcgcatgcc
ctggcttatttggagaagctgtgcccaaccctcccaaatgggactaaggttgtacttaat
tgcagtgggagaggagataaggatgttcatacagccattaagcatttgcaggtttga

DBGET integrated database retrieval system