KEGG   Vitis vinifera (wine grape): 100264314Help
Entry
100264314         CDS       T01084                                 

Definition
delta-aminolevulinic acid dehydratase, chloroplastic-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100264314
Enzymes [BR:vvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100264314
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100264314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 430 aa AA seqDB search
MASMFLNAPCNVGAIKHFDCKNYVGLRASSNQKLDCVGHTIKAPPRRRFIVRASERRDES
MKKMGLTDQECEAAVVAGNVPEAPPVPPKPAAPAGTPSVPFLPLNRRPRRNRRSPVLRAS
FQETNLSPANFVYPLFIHEGEEDTPIGAMPGCYRLGWRHGLLEEVAKARDVGVNSVVLFP
KVPDALKSPTGDEAFNDNGLVPRTIRLLKDRYPDLVIYTDVALDPYSSDGHDGIVREDGV
IMNDETVHQLCKQAVAQAKAGADVVSPSDMMDGRVGAIRAALDAEGFQHVSIMSYTAKYA
SAFYGPFREALDSNPRFGDKKTYQMNPANYREALTEVREDESEGADILLVKPGLPYLDVI
RLLRDNSSLPIAAYQVSGEYSMIKAGAVLKMIDEEKVMMESLMCLRRAGADIILTYFALQ
AARCLCGEKR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgatgttccttaatgcgccctgcaatgttggggcaattaagcattttgattgc
aagaactatgttggactgagggcatcatcgaatcagaagttggattgtgttgggcacaca
atcaaggcgcctccacgacgtcgttttattgtaagagccagcgaaaggagggatgaatcc
atgaaaaaaatgggattgactgatcaagagtgtgaagctgcggttgtggccggaaatgtg
ccggaagcgcctcccgtgcctcccaagccggcggccccagctggaactccgtcggttcct
tttcttccacttaatcgacgccctcgtcgtaatcgaaggtcgcctgtattgagggcatca
ttccaggaaacaaatttatctcctgcaaattttgtctatccactctttattcatgaaggt
gaagaggacacccctattggagccatgcctggatgttataggctaggatggagacatgga
cttctggaggaggttgcaaaggcccgggatgttggtgtaaacagtgttgtgctctttcct
aaagttccagatgccttgaagtctcccacaggagatgaagcattcaatgacaatggttta
gtgccccggacaattcgattgctcaaagacagataccctgatcttgttatctacactgat
gttgctttagatccgtattcctctgatgggcatgatggtattgtcagagaagatggagtc
ataatgaatgatgagacagtgcatcaattatgtaaacaagctgttgctcaggctaaggca
ggagcagatgttgttagtcccagtgacatgatggatggtcgtgtaggagcaattcgagca
gctcttgatgctgaaggctttcaacatgtgtctatcatgtcctatacagcaaagtatgca
agtgcattttatggtccattccgagaagcattggactcaaatccacgctttggagacaaa
aaaacttatcagatgaacccagcgaattacagagaggctctgactgaggtccgtgaagat
gagtctgaaggagctgatatccttttggtgaaacctggtctgccttacttggatgtcata
aggctgcttcgggataactcgtcattgccaattgctgcatatcaggtttctggtgaatac
tcaatgatcaaggctggtgctgttctcaaaatgattgatgaagaaaaagtcatgatggag
tcactgatgtgtcttcgacgggctggtgcagacatcatcctcacgtattttgcactacaa
gctgctcgttgtttatgcggtgagaagaggtga

DBGET integrated database retrieval system