KEGG   Vitis vinifera (wine grape): 100264550Help
Entry
100264550         CDS       T01084                                 

Definition
histone deacetylase 2-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100264550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 359 aa AA seqDB search
MSTAPVNPASVSSSTSASDAETLRRGRILSSKLYFDVPLTKVPIIYSSSYDIAFLGMEKL
HPFDSSKWGRICRFLILDGALEKNHIVEPLEASKDDLLVVHSESYLNSLKTSLNVAVIIE
VPPVALLPNCLVQQKVLYPFRKQVGGTILAAKLAKERGWAINVGGGFHHCSAGKGGGFCA
YADISLCIHYAFIRLNISRVMIIDLDAHQGNGHELDFSNDRRVYILDMYNPGIYPSDFEA
RRYIDQKVEVVSGTTTNEYLTKLDEALKVAGRMFDPELVVYNAGTDILDGDPLGRLKISP
EGVTSRDEKVFRFAREKKIPLIMLTSGGYMKSSAKVIADSIVNLSRKCLIDTGSSHSRG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgcgcctgtaaatcccgcttccgtttcttcctcaacttctgcaagcgacgcg
gagactctccggcgaggccgtatcctctcaagcaagctctacttcgatgtgcctctcact
aaggttccaattatttactcgtcgtcgtacgacattgcgtttcttggcatggaaaaactg
cacccatttgattcttctaagtggggtcgcatatgccggttccttatcttggatggtgct
ttggagaaaaaccatattgttgagcctctggaagcttcaaaggatgatctcctagtggta
cattcagaatcatacttgaatagtctgaaaaccagtctcaatgttgctgttataattgag
gtcccccctgttgcattactgcccaattgtcttgtgcagcagaaagttctttatccattt
cgcaagcaggttgggggaaccattttggctgcaaagcttgcaaaagagcgaggatgggcc
atcaatgtcggtggagggttccatcactgttctgcaggaaaaggtggtggattctgtgct
tatgcagatatttctctttgcatacactatgcctttatccggttgaatatttctagggtg
atgataattgatcttgatgcacatcaaggaaatggccatgaattggatttttccaatgac
agacgagtttatattctggatatgtacaaccctgggatatatccatctgattttgaggca
aggagatatattgatcagaaggttgaagtagtgagtgggaccacaactaatgagtacctg
acaaaattagatgaagcactcaaggttgctggacgcatgtttgatcctgagttggtggtg
tataatgctggcactgatatcctagatggagatccactgggaaggttgaagatcagtcct
gaaggggtaactagtagagatgagaaggttttcagatttgctcgtgagaagaaaattcct
ctcatcatgctcacatcaggtggttatatgaaatccagtgccaaagtaatagcagattca
atagtaaacctgtcgaggaaatgcttgatagacactgggagttctcattcccggggttaa

DBGET integrated database retrieval system