KEGG   Vitis vinifera (wine grape): 100264578Help
Entry
100264578         CDS       T01084                                 

Definition
AMSH-like ubiquitin thiolesterase 1
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100264578
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100264578
Peptidases [BR:vvi01002]
 Metallo Peptidases
  Family M67
   100264578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 506 aa AA seqDB search
MRPSSGGINIAASAQKLDVDNRISLRYYYRIADNILKQADIFREEKNIIDLYIMLLRFSS
LTSETIPCHRDYKASLQSKKNYLKKNLLRALCELEELKPAVRQKIDELNQKHTYQVNRWG
ADSSLEWPHVRKQTLTKHEMTKTPRPTARDFEYQGSKIQQFSRAKPVEEQFRRLSVGILR
PREETLSRHSILGPNGLHGQWQPPTIDKRVQYPSNLDLTPVQFPSLQHHVEDGLMNNNEA
SSSEHEQSSLESVLTLNEDNQIHPAEELGSLISFETTETPHTEIIRQPSPPPVLADVQDL
IPETPTQVSEVNGQMETPSTDGLVCSEAPLEMHISTVLMESFLKLAKSNTVRNLETCGIL
AGSLKNRKFYVTALIIPKQESTSDSCQTTNEEEIFEVQDKQSLFPLGWIHTHPTQSCFMS
SVDLHTHYSYQTMLPEAIAIVMAPKDASKKHGIFRLTTPGGMSVIRHCDQRGFHPHHSPS
DGGPIYKSCTDVYMNPNIHFDVIDLR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcggccttcttcgggaggaatcaacatcgccgccagtgctcagaaactcgatgtcgat
aatcggatttccctccgttactactaccgtatcgctgataatatcctcaaacaggctgac
atatttcgagaagagaagaacattatagatctctatattatgcttctaaggttttcaagt
ttaacttctgagactataccatgccatcgtgattataaggcatctctacaaagcaaaaag
aattatttgaagaagaacttattgagagccctgtgtgagttggaggaattgaagccagct
gtgcgacagaagattgatgaattgaaccagaaacatacatatcaagtaaacagatggggt
gctgattcctcactggaatggcctcatgttaggaaacaaactttgacgaaacatgagatg
acaaagacaccacgacccactgctcgagattttgaatatcaaggttcaaagattcagcag
ttctcgcgagccaagccagtggaagagcaattccgcagactatctgttggtatcctgcgc
ccaagggaggaaactctatccagacactctattttgggtccaaatggacttcatgggcag
tggcagccacctaccattgataaaagggtccaatatccaagcaatttagatttgactcca
gttcaatttccaagtctgcagcatcatgtggaggatggacttatgaataacaatgaagct
agcagctcagaacatgagcaatctagtttggaatcagtccttacactgaacgaggataat
cagattcatcctgctgaggaactgggttccttgatttcttttgaaaccacagaaactcct
catacagagattatcagacagccttctcctccacctgttctggcagacgtacaagatttg
atcccagagactcccacccaagttagtgaggtaaatggccaaatggagaccccatcaacg
gatgggttagtttgttctgaagctcccctcgaaatgcacatttcaactgtattgatggaa
agcttcttgaagcttgctaagtcgaacactgtcaggaatttggaaacttgtggtatcctt
gcaggttcacttaagaacagaaaattttatgtcacagctctcattattccgaagcaggag
tcaacatcagattcatgtcagaccacaaatgaagaggaaatttttgaagtgcaggataag
caatccctcttccctcttgggtggatacatactcatcctacccagtcgtgtttcatgtct
tctgttgatcttcatacccattactcatatcagactatgctaccggaagccatagcaatt
gtcatggcaccaaaggatgcttcaaaaaagcatggcattttccgcctgacaactccaggt
ggcatgtcagtcataagacactgcgaccaacgtggctttcatccacatcattctccttcg
gatggtgggcccatctacaaaagctgtacagatgtttatatgaatcccaatatacatttt
gatgtcattgatcttcggtga

DBGET integrated database retrieval system