KEGG   Vitis vinifera (wine grape): 100265100Help
Entry
100265100         CDS       T01084                                 

Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100265100
Enzymes [BR:vvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100265100
Transporters [BR:vvi02000]
 Other Transporters
  Pores ion channels [TC:1]
   100265100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4
AA seq 145 aa AA seqDB search
MAAEDLLPREYGYVVLVLVFYCFLNFFMAISVGKARKKYKVSFPNLYALESENKDAKLFN
CVQRGHQNSLEMMPVFFVLMILGGIGYPLTCAALGSLYIVSRYFYFTGYSTGNPENRLKI
GKFSFLAIPGLMICNILFAINLVRG
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagaggatttgcttcccagagaatacggatatgtggttcttgttctcgttttc
tactgctttctcaatttcttcatggctatcagcgtaggcaaagcccggaagaagtataag
gtgtctttccctaacctgtatgcgttggaatctgaaaacaaggatgccaagctcttcaac
tgtgtccagagagggcatcaaaattcgctggaaatgatgccagtgttcttcgtgctgatg
atattaggaggaattggatatcctcttacatgtgctgctcttggatccctatacattgtc
agtcgatatttctatttcactggctattccaccggcaatcccgaaaaccgattgaagatc
gggaaattttcatttttggcgatcccggggcttatgatttgcaacattttgtttgctatc
aaccttgttcgtggatga

DBGET integrated database retrieval system