KEGG   Vitis vinifera (wine grape): 100265209Help
Entry
100265209         CDS       T01084                                 

Definition
protein disulfide isomerase-like 1-6
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100265209
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100265209
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100265209
  Exosomal proteins of colorectal cancer cells
   100265209
  Exosomal proteins of bladder cancer cells
   100265209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 537 aa AA seqDB search
MFAAKPTSRFVYLTVTLLLLLSFFVSITAYETSDGNGDGEDEFEGIEELIALDEEEESQQ
NQGSHVKSTEAEVIVKAQRIVLELNSDNTKRIIDGNEYVLVLGYAPWCPRSAELMPQFAE
AATSLKELGSPLLMSKLDAERHPKTASSLGISGFPTLLLFTNGTSQPYTGGFSSEEIVIW
VRKKTGVPVIRINSVTEAEEFLKKHHTFAIGLFKKFVGCEYEEFVKAATSHNEIQFVEVN
DIEVAKVLFPNIKPNSLFLGLVKSEMERYTTYEGTFEMDQILDFLDYNKFPLVTILTELN
SIKVYSSPVKFQVFVFAKADAFKNLLKLLQDVARKFVSKIMIVYVDITEDNLAKPFLTLF
GLEDSEDTIVTAFDNKISSKYLLESDPTPSKIEEFCSGLLQGTLSPHFRSQAIPDNKEES
VQIVVGKTFDNLVLSGDKNVLLEVYSPWCIDCETTSKQMKKLAKHFKGLDNLIFARIDAS
ANEHPKLKVDDYPTLLFYKADDKSNPIKLSTKSSSKDLAAFINKNIGVQDQVSKDEL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgcaaaacccacctcaagattcgtctatttgactgtcacccttttgctgttg
ctgagttttttcgtctctattactgcctatgagaccagtgatggtaacggtgatggtgag
gatgagtttgagggcattgaagagcttatagcattggatgaagaggaggaatcgcagcaa
aaccaagggagccatgtgaagtcgactgaggctgaggttatagtcaaagcccaaaggata
gtacttgaactcaacagtgataacaccaagaggatcattgatgggaatgagtatgtttta
gttctgggttatgcgccttggtgccccagaagtgcggagctcatgcctcaatttgcagag
gcggcaacatcgctcaaggaattggggagtcctctgttgatgtccaaactcgatgccgag
cggcatcctaaaacggcgtcgtctcttgggatcagtggctttccaactctgcttctgttc
accaatgggacttctcaaccttacactggtggcttttcttcggaagaaatagtgatatgg
gtaaggaagaagactggtgtacctgttatcaggataaactcggtaactgaggcagaagag
tttcttaagaagcaccatacgtttgctattggtttattcaagaaatttgtgggatgcgag
tatgaggagtttgtaaaagcagcaacttctcacaatgaaatccagtttgttgaagtgaat
gacatcgaggttgccaaagttctcttccctaacattaaacctaatagtcttttccttggc
cttgttaaaagtgagatggaaagatacacaacatatgaaggcacctttgaaatggaccaa
atactggactttttggactacaacaagtttccattggttaccatattgactgaacttaat
tctatcaaagtatattcgagtcctgtcaaattccaggtttttgtctttgcaaaggctgat
gcctttaagaatcttcttaagcttctacaggatgttgcaagaaagttcgtttccaagata
atgattgtatacgttgacattactgaggacaaccttgcaaagcccttcttgactttgttt
gggcttgaagactcagaagacactatagtgactgcttttgataacaaaatcagctcaaag
tatttgttagagtcagatccaacaccaagcaaaattgaagagttctgctcagggcttctg
cagggtactctatcaccacacttcagatcacaggcaataccagataacaaagaggaaagt
gtccagattgttgtgggaaagacatttgataacttggttttgagcggtgacaagaatgtc
cttcttgaggtatacagtccttggtgcattgattgtgagaccacgagcaagcagatgaag
aagttggccaagcacttcaaagggttagataatctaatttttgcgaggatagatgcttct
gcaaatgaacatccaaaactgaaggtagatgattacccaacactcttattttacaaggcg
gatgacaaatcaaatccgatcaagctttctacaaaatctagctcaaaggacttggcagca
ttcatcaacaaaaatataggagtccaagaccaagtaagcaaagatgaactatag

DBGET integrated database retrieval system