KEGG   Vitis vinifera (wine grape): 100265800Help
Entry
100265800         CDS       T01084                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100265800
Enzymes [BR:vvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100265800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 371 aa AA seqDB search
MALSSSKHWPFSPTQDSLNGSLRTTPVQLHLIRNPSPSQSRSPFPSLSLNASKAPSPQTQ
VTGPPLVVVGSANADIYVEIDRLPKEGETVSAKHGQTLAGGKGANQAACGGKLSYPTYFV
GQVGEDAHGKLISEALKDGGVCLDHLSTVSAAPTGHAVVMLQSDGQNSIIIVGGANMSFW
PDTLSDEDLKIVRNAGIVLLQREIPDFVNIQVAKAARDAGVPVILDAGGMDAPIPVELLN
VVDILSPNESELARLTRMPTESFEQISQAVAKCHEMGVKEVLVKLGEKGSALFVKGEEPI
RQPIIYAAKVLDTTGAGDTFTAAFAVAFVEGRSKKECLRFAAAAASLCVQVKGAIPSMPD
RRSVLDLLQTC
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcactttcatcctcaaagcactggcccttctcaccaacccaagacagtctcaacgga
agcctcagaacaaccccagttcaacttcacttgatcagaaacccgtctccatcacaatca
agatctccctttccatccttgtctcttaatgcttccaaggccccgtccccacaaacccag
gtcaccggtccgcctctggtggttgtgggatcagccaatgccgacatctatgtggagatt
gataggcttccaaaggagggcgagacagtctcagccaagcatggccagactctggccggt
gggaaaggggctaaccaggctgcttgtggtgggaagctatcataccccacatactttgtg
gggcaggtgggtgaggatgctcatgggaagttgatttctgaggcacttaaggatggtggg
gtttgtctcgatcatctcagcactgtatctgctgcgcccactggccatgctgtggtgatg
cttcagtccgatggccagaactccattatcattgttgggggtgccaatatgtctttttgg
cctgacactctctctgatgaggatttgaagattgtgaggaatgccgggattgtattgctt
cagagggaaattcctgatttcgtcaacattcaggttgcaaaggctgcaagggatgctggt
gttccagtcattttggatgcaggagggatggatgcaccaatcccagtagaattactgaat
gttgttgatattctaagcccaaatgaaagtgaacttgcacgactaaccagaatgccaact
gaaagttttgaacagattagccaagctgtggcaaaatgtcatgaaatgggtgttaaagaa
gtcctggtgaaactgggggagaaggggtcagctttgtttgtaaaaggggaagaaccaatt
agacaaccaatcatatatgctgcaaaagttctcgataccaccggagcaggcgataccttt
actgctgcatttgctgtggcttttgtggagggcaggtctaaaaaggaatgcttgaggttt
gctgctgctgcagcttctctctgtgttcaagtgaagggggccattccaagcatgcctgac
agacggtcagttttggatcttctacagacctgttga

DBGET integrated database retrieval system