KEGG   Vitis vinifera (wine grape): 100265912Help
Entry
100265912         CDS       T01084                                 

Definition
probable polyprenol reductase 2-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
vvi  Vitis vinifera (wine grape)
Brite
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100265912
    1.3.1.94  polyprenol reductase
     100265912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 338 aa AA seqDB search
MELDLVALLRAAWIAGTLPILIASIPSSRLHSFHGLVLGFARRGKTMPSSSYKFTVPQRF
FCHFYVVAVVWTTLLVLATLLYAYRMAPLVSEPLLYSTVASQLTGGSHIFSLHKSRSTPL
EHRYLVWRSVFLLLLMEVQVMRRLYETIYVFNYSSSARMHVFGYLTGLFFYTAAPLSLCC
VCAPEVFKFAANQLKEFIVKGKNQMPVIEFDWWGYMSSLMKLGWPSWLGAAIFIWGWIHQ
HRCHAILGLLQEHKEQEGEYGIPDGDWFEIVSSPHYLAEIVIYGGLVVASGGSDLTIWLL
FGFVASNLIFAAAETQRWYLHKFDNYPSNRFAIIPFVY
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggagctagaccttgttgctttgctcagagccgcctggattgctggaacattgcccata
ctcatagcctccattccctcttctcgtctccattcctttcatgggcttgtgttggggttt
gctaggagagggaaaaccatgccatcctcatcatacaaattcaccgttccacaaagattc
ttctgccatttctatgtggtggcagtggtgtggacaacgttgttggttcttgcaactttg
ctatatgcatacagaatggcaccattggtctctgaaccattgctttattccaccgttgcg
agccagttgactggaggttcacatatcttttccttgcataaatctcgttcgactccactt
gagcatagataccttgtttggcgatccgtgttcctgcttttgttgatggaagtccaagta
atgagacgcctttatgagacaatatatgtttttaattatagcagctcagctcggatgcat
gtttttggttatctgactggcctgtttttctacacagcagcaccactgtcactctgctgc
gtttgtgcaccagaggtatttaaatttgctgcaaatcaattgaaggaattcatcgttaaa
ggcaagaatcagatgcctgtcattgaatttgattggtggggatacatgagttctctcatg
aagcttggatggccctcctggcttggtgcagctatattcatttggggttggattcatcag
catcgttgtcatgcaattctcggcttgttgcaagagcataaggagcaagaaggtgaatac
ggaatccctgatggggattggtttgaaatagtctcttctccgcactacctggctgagatt
gttatatacggtggccttgtggtggctagtgggggttcagacttgacaatctggttactt
tttggatttgtggcatcaaatctcatatttgcagcagcagaaacacagaggtggtatctc
cataaatttgacaattaccccagcaatcggtttgccattattccatttgtttactag

DBGET integrated database retrieval system