KEGG   Vitis vinifera (wine grape): 100266092Help
Entry
100266092         CDS       T01084                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:vvi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 112 aa AA seqDB search
MATFADAPAGNAAAGEKIFRTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAA
NKNMAVAWGENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgttcgctgatgcaccggcgggtaatgctgccgcgggagagaagatcttcagg
accaagtgcgcccagtgccacactgtcgataaaggagctggtcacaagcaaggacctaat
ttgaatggtctttttgggaggcagtctggcacaactgctgggtactcctattctgctgct
aacaagaacatggctgtggcttggggagagaatacattgtatgattacttgcttaaccca
aagaagtacattcccggaacaaagatggttttcccgggattgaagaagccacaggatcgc
gcagacctcattgcttatctgaaggaatcaactgcttga

DBGET integrated database retrieval system