KEGG   Vitis vinifera (wine grape): 100266283Help
Entry
100266283         CDS       T01084                                 

Definition
chorismate mutase 02
Orthology
K01850  
chorismate mutase [EC:5.4.99.5]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100266283
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100266283
Enzymes [BR:vvi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     100266283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 320 aa AA seqDB search
MEAKLLKAASPSVILPQGSKISKPSSYFTSKTNHCSSCRFPSLKNRVIQSIHVSPTPLRF
ERKKRVDESQNLTLDAIRNSLIRQEDSIIFSLLERAQYCYNAETYDPDALSMDGFHGSLV
EFMVRETEKLHAQVGRYKSPDEHPFFPVELPEPMLPPLQYPKVLHPGSDLININEQIWSM
YFRDLLPRLVKEGDDGNYGSAAVCDTICLQALSKRIHYGKFVAEAKFQASPDAYEAAIKA
QDSQRLMDMLTYQRVEDVVKMRVEMKTKAYGQEVVVNGMEDDDAGPVYKIKPSLVADLYG
DWIMPLTKEVQVAYLLRRLD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaagctgttgaaagccgcctctccttccgttattctaccccagggttcaaaa
atttcaaaacccagttcctatttcacctccaagaccaaccattgttccagttgtaggttc
ccaagtttgaagaacagggttatccagtctattcatgtctctccaactcctctcaggttt
gaaaggaaaaaaagagtagatgagagtcagaacttgactttggatgctataagaaattct
ttaattcgacaagaggatagcataatatttagcctcttggaaagagctcagtattgttac
aatgccgagacatatgatcccgatgctttgtcaatggatgggttccatggctctttggtt
gaattcatggtcagggaaaccgaaaagcttcatgctcaggtgggcaggtacaagagccct
gatgagcatcctttcttcccagttgagttgcctgaaccaatgttgccacctttacagtac
ccaaaggtactgcatcctggttcagatttgatcaatattaatgagcaaatatggagtatg
tatttcagagaccttcttccaagactagtcaaggaaggagatgatggaaactatggatca
gcagctgtttgtgacacaatttgcttgcaggctctgtcaaagagaatccactatggcaag
ttcgtggcagaggcaaaattccaagcctccccagatgcatacgaagctgccatcaaagca
caagacagccagcggctgatggatatgctgacttaccagagggttgaagatgtagtgaag
atgagagtggagatgaaaaccaaagcctacgggcaagaggtagtggtgaatgggatggaa
gacgatgatgccggtccggtctacaaaataaaaccgagcttggttgcagatctgtatggg
gactggatcatgccattaacaaaggaggttcaagtggcctacttgcttagaaggttggac
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system