KEGG   Vitis vinifera (wine grape): 100266283Help
Entry
100266283         CDS       T01084                                 

Definition
chorismate mutase 02
Orthology
K01850  
chorismate mutase [EC:5.4.99.5]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vvi01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vvi00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 320 aa AA seqDB search
MEAKLLKAASPSVILPQGSKISKPSSYFTSKTNHCSSCRFPSLKNRVIQSIHVSPTPLRF
ERKKRVDESQNLTLDAIRNSLIRQEDSIIFSLLERAQYCYNAETYDPDALSMDGFHGSLV
EFMVRETEKLHAQVGRYKSPDEHPFFPVELPEPMLPPLQYPKVLHPGSDLININEQIWSM
YFRDLLPRLVKEGDDGNYGSAAVCDTICLQALSKRIHYGKFVAEAKFQASPDAYEAAIKA
QDSQRLMDMLTYQRVEDVVKMRVEMKTKAYGQEVVVNGMEDDDAGPVYKIKPSLVADLYG
DWIMPLTKEVQVAYLLRRLD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaagctgttgaaagccgcctctccttccgttattctaccccagggttcaaaa
atttcaaaacccagttcctatttcacctccaagaccaaccattgttccagttgtaggttc
ccaagtttgaagaacagggttatccagtctattcatgtctctccaactcctctcaggttt
gaaaggaaaaaaagagtagatgagagtcagaacttgactttggatgctataagaaattct
ttaattcgacaagaggatagcataatatttagcctcttggaaagagctcagtattgttac
aatgccgagacatatgatcccgatgctttgtcaatggatgggttccatggctctttggtt
gaattcatggtcagggaaaccgaaaagcttcatgctcaggtgggcaggtacaagagccct
gatgagcatcctttcttcccagttgagttgcctgaaccaatgttgccacctttacagtac
ccaaaggtactgcatcctggttcagatttgatcaatattaatgagcaaatatggagtatg
tatttcagagaccttcttccaagactagtcaaggaaggagatgatggaaactatggatca
gcagctgtttgtgacacaatttgcttgcaggctctgtcaaagagaatccactatggcaag
ttcgtggcagaggcaaaattccaagcctccccagatgcatacgaagctgccatcaaagca
caagacagccagcggctgatggatatgctgacttaccagagggttgaagatgtagtgaag
atgagagtggagatgaaaaccaaagcctacgggcaagaggtagtggtgaatgggatggaa
gacgatgatgccggtccggtctacaaaataaaaccgagcttggttgcagatctgtatggg
gactggatcatgccattaacaaaggaggttcaagtggcctacttgcttagaaggttggac
tga

DBGET integrated database retrieval system