KEGG   Vitis vinifera (wine grape): 100266308Help
Entry
100266308         CDS       T01084                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vvi00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 306 aa AA seqDB search
MPFNIVHGADGFPRVILTDLTGSSAEVLLYGGQVVSWKNERREEFLFMSRKAERKPPKAI
RGGIPVCFPQFGNFGSLEQHGFARNRLWSLDSNPSPLSPSNSQSSVDLILKSTQEDVRTW
PRRFELRLRISLSDGKLTMIPRVRNTDSKPFSFMFALRNYLSVSDVSEVRVEGLETLDYF
DNLMQRERYTEQADAITFDGEIDRVYLRTPTKIAIIDHEKKRTIVLRKEGMPDAAVWNPW
DKKAKALPDMGDEDYKTMLCVDSAAIEAPIVLKPFEEWRGRQELSTVSSSYCSGQLDPRK
VLHGLI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcaatatagttcacggcgccgatggctttccccgagtcatactcaccgacctc
accggatcatcggcggaggtgcttttgtatggcgggcaggttgtttcgtggaagaacgaa
aggagggaagagtttctttttatgagcaggaaggccgaaaggaaaccgcccaaagccatc
aggggaggtatacctgtctgctttccacagtttggaaatttcggttcactggagcaacat
ggatttgcaaggaacagattatggtcattagatagcaacccttcacctttgtctccatct
aacagtcagtcatcagtggatcttatattgaagtccactcaagaggatgtaagaacctgg
ccacggagatttgagttgcggctccgtatttctctcagtgatggcaagctcacgatgatc
ccccgtgtgagaaatacagatagcaagccattctcttttatgtttgctctgcgtaactac
ttatctgtatcggatgtcagtgaagtacgggttgagggcctggagacactcgactacttt
gataatctgatgcaaagagagaggtacacagagcaggcagatgcaattacctttgatggc
gagatcgaccgagtatatttgcgcaccccaacaaagattgctataatagaccatgaaaag
aagagaactattgtgttgcgtaaagaaggcatgccagatgcagctgtatggaatccttgg
gacaaaaaagccaaggctcttccagatatgggggatgaggattacaaaaccatgttatgt
gtggattcagctgctattgaagccccaatcgtcttgaaaccctttgaagagtggagagga
cgtcaagaactatctactgtgtcatcgagttattgcagtgggcagttggatcctcgtaag
gttcttcatggccttatttaa

DBGET integrated database retrieval system