KEGG   Vitis vinifera (wine grape): 100266308Help
Entry
100266308         CDS       T01084                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100266308
Enzymes [BR:vvi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100266308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 306 aa AA seqDB search
MPFNIVHGADGFPRVILTDLTGSSAEVLLYGGQVVSWKNERREEFLFMSRKAERKPPKAI
RGGIPVCFPQFGNFGSLEQHGFARNRLWSLDSNPSPLSPSNSQSSVDLILKSTQEDVRTW
PRRFELRLRISLSDGKLTMIPRVRNTDSKPFSFMFALRNYLSVSDVSEVRVEGLETLDYF
DNLMQRERYTEQADAITFDGEIDRVYLRTPTKIAIIDHEKKRTIVLRKEGMPDAAVWNPW
DKKAKALPDMGDEDYKTMLCVDSAAIEAPIVLKPFEEWRGRQELSTVSSSYCSGQLDPRK
VLHGLI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcaatatagttcacggcgccgatggctttccccgagtcatactcaccgacctc
accggatcatcggcggaggtgcttttgtatggcgggcaggttgtttcgtggaagaacgaa
aggagggaagagtttctttttatgagcaggaaggccgaaaggaaaccgcccaaagccatc
aggggaggtatacctgtctgctttccacagtttggaaatttcggttcactggagcaacat
ggatttgcaaggaacagattatggtcattagatagcaacccttcacctttgtctccatct
aacagtcagtcatcagtggatcttatattgaagtccactcaagaggatgtaagaacctgg
ccacggagatttgagttgcggctccgtatttctctcagtgatggcaagctcacgatgatc
ccccgtgtgagaaatacagatagcaagccattctcttttatgtttgctctgcgtaactac
ttatctgtatcggatgtcagtgaagtacgggttgagggcctggagacactcgactacttt
gataatctgatgcaaagagagaggtacacagagcaggcagatgcaattacctttgatggc
gagatcgaccgagtatatttgcgcaccccaacaaagattgctataatagaccatgaaaag
aagagaactattgtgttgcgtaaagaaggcatgccagatgcagctgtatggaatccttgg
gacaaaaaagccaaggctcttccagatatgggggatgaggattacaaaaccatgttatgt
gtggattcagctgctattgaagccccaatcgtcttgaaaccctttgaagagtggagagga
cgtcaagaactatctactgtgtcatcgagttattgcagtgggcagttggatcctcgtaag
gttcttcatggccttatttaa

DBGET integrated database retrieval system