KEGG   Vitis vinifera (wine grape): 100266446Help
Entry
100266446         CDS       T01084                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100266446
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100266446
Chaperones and folding catalysts [BR:vvi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100266446
Membrane trafficking [BR:vvi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100266446
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100266446
  Exosomal proteins of colorectal cancer cells
   100266446
  Exosomal proteins of bladder cancer cells
   100266446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
7
AA seq 500 aa AA seqDB search
MRMVFPMECKCLFSVLVLFSSLLALCTVPISAVEGEFVVTLDYSNFTETVAKQDFIVVEF
YAPWCGHCQQLAPEYEKAASVLSSHDPPIILAKVNGDDAANRQLGQKFDIKGFPTLFIVK
DGGKKVQEYNGPPDADGIVNYLKRQLGPASTEIKSSEDAATFIDEKGVAIVGVFPDFSGE
EFDNFISIAENLRSDYVFGHTLDAKLLPRGESSVKGPIVRLFKPFDELYVDFQDFEVDAL
EKFVKEASMPLVTIFDSDPSGHGYVAKFFDLPNDKVMLVVEFNSEEFDAFNSKYRDAAEL
YKGKNLGFLLGDVNVSEGAVEYYGLKADQTPLIIIDNNDLDTRYFEAKIKPDQIAPWLEE
YLDGRLKPFIKSQPIPETNDGPVKVAVFETLEEIVFNSGKNVLIEFYAPWCGHCQRLAPI
LEEAAVSFQNDPDIIIAKLDATVNDIPKKFKVEGFPTMYFKPANGELVEYGGDATKEAII
DFIKEKRDKSIQEGSARDEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggtgtttcccatggagtgcaagtgtttgttctccgtcttagtgttgttttct
tctctactggctttgtgtacagtgcccatctctgcagttgaaggagagtttgttgtgact
ttggattattccaacttcactgaaactgtcgccaagcaagacttcattgttgttgagttc
tatgctccatggtgtgggcactgtcagcaactcgctccagagtatgaaaaagctgcgtcc
gtattgagtagccatgatcctccaatcattctggccaaagttaatggagatgatgcagca
aacagacaactcggacagaagtttgacatcaaaggtttccccaccctctttattgtgaaa
gatggaggaaagaaagttcaagaatataacggccctcccgacgctgatgggatagtaaat
tatctaaaaagacaacttggtcctgcatccactgaaataaaatcttctgaggatgctgca
actttcatagatgagaaaggggtcgccattgttggagtgtttccagatttctcaggagaa
gaatttgacaacttcattagtatagctgaaaatctgcgttctgactatgtatttgggcac
actttggacgccaagcttcttcctcggggtgaatcatcagtcaaggggccaattgtgaga
ctgtttaagccatttgatgagctctatgttgatttccaggattttgaagtagatgctttg
gaaaagtttgttaaagaagcttctatgcctttggtcaccattttcgattctgatccaagt
ggccatggttatgttgctaagttcttcgacctacctaatgacaaggtcatgctggtcgtg
gagttcaatagtgaggagtttgatgctttcaactcgaagtatcgtgatgctgccgagctc
tacaaaggaaagaacttgggctttctattgggtgatgtcaacgttagtgaaggtgctgtt
gagtattacgggctgaaggcagatcaaacacctctgatcatcatagataacaatgacctg
gacaccagatattttgaagccaagatcaagcctgatcaaattgcaccctggttggaggaa
tacttggatggcagattgaagccattcatcaagtcgcagcctattcctgaaactaatgac
ggacccgtgaaagtggctgtttttgaaacactggaggagattgtgttcaactctggaaag
aacgttctcatagaattttatgcaccttggtgtggacattgccagaggctggctccaatc
ttggaagaagctgctgtctcattccagaatgatcccgatatcatcatcgccaaactggat
gcaactgtaaatgatatcccaaagaagtttaaggttgaaggtttcccaactatgtatttt
aaaccggcaaacggggagcttgtggaatatggaggcgatgcaaccaaggaggctatcatt
gattttattaaggagaagcgtgacaagagtatccaagaagggtccgcaagagatgagctt
tga

DBGET integrated database retrieval system