KEGG   Vitis vinifera (wine grape): 100266446Help
Entry
100266446         CDS       T01084                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100266446
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100266446
Chaperones and folding catalysts [BR:vvi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100266446
Membrane trafficking [BR:vvi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100266446
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100266446
  Exosomal proteins of colorectal cancer cells
   100266446
  Exosomal proteins of bladder cancer cells
   100266446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 AhpC-TSA OST3_OST6 ERp29_N Redoxin Glutaredoxin TraF Thioredoxin_9 Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 100266446
NCBI-ProteinID: XP_010652943
UniProt: D7SWG9
Position
7
AA seq 500 aa AA seqDB search
MRMVFPMECKCLFSVLVLFSSLLALCTVPISAVEGEFVVTLDYSNFTETVAKQDFIVVEF
YAPWCGHCQQLAPEYEKAASVLSSHDPPIILAKVNGDDAANRQLGQKFDIKGFPTLFIVK
DGGKKVQEYNGPPDADGIVNYLKRQLGPASTEIKSSEDAATFIDEKGVAIVGVFPDFSGE
EFDNFISIAENLRSDYVFGHTLDAKLLPRGESSVKGPIVRLFKPFDELYVDFQDFEVDAL
EKFVKEASMPLVTIFDSDPSGHGYVAKFFDLPNDKVMLVVEFNSEEFDAFNSKYRDAAEL
YKGKNLGFLLGDVNVSEGAVEYYGLKADQTPLIIIDNNDLDTRYFEAKIKPDQIAPWLEE
YLDGRLKPFIKSQPIPETNDGPVKVAVFETLEEIVFNSGKNVLIEFYAPWCGHCQRLAPI
LEEAAVSFQNDPDIIIAKLDATVNDIPKKFKVEGFPTMYFKPANGELVEYGGDATKEAII
DFIKEKRDKSIQEGSARDEL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagaatggtgtttcccatggagtgcaagtgtttgttctccgtcttagtgttgttttct
tctctactggctttgtgtacagtgcccatctctgcagttgaaggagagtttgttgtgact
ttggattattccaacttcactgaaactgtcgccaagcaagacttcattgttgttgagttc
tatgctccatggtgtgggcactgtcagcaactcgctccagagtatgaaaaagctgcgtcc
gtattgagtagccatgatcctccaatcattctggccaaagttaatggagatgatgcagca
aacagacaactcggacagaagtttgacatcaaaggtttccccaccctctttattgtgaaa
gatggaggaaagaaagttcaagaatataacggccctcccgacgctgatgggatagtaaat
tatctaaaaagacaacttggtcctgcatccactgaaataaaatcttctgaggatgctgca
actttcatagatgagaaaggggtcgccattgttggagtgtttccagatttctcaggagaa
gaatttgacaacttcattagtatagctgaaaatctgcgttctgactatgtatttgggcac
actttggacgccaagcttcttcctcggggtgaatcatcagtcaaggggccaattgtgaga
ctgtttaagccatttgatgagctctatgttgatttccaggattttgaagtagatgctttg
gaaaagtttgttaaagaagcttctatgcctttggtcaccattttcgattctgatccaagt
ggccatggttatgttgctaagttcttcgacctacctaatgacaaggtcatgctggtcgtg
gagttcaatagtgaggagtttgatgctttcaactcgaagtatcgtgatgctgccgagctc
tacaaaggaaagaacttgggctttctattgggtgatgtcaacgttagtgaaggtgctgtt
gagtattacgggctgaaggcagatcaaacacctctgatcatcatagataacaatgacctg
gacaccagatattttgaagccaagatcaagcctgatcaaattgcaccctggttggaggaa
tacttggatggcagattgaagccattcatcaagtcgcagcctattcctgaaactaatgac
ggacccgtgaaagtggctgtttttgaaacactggaggagattgtgttcaactctggaaag
aacgttctcatagaattttatgcaccttggtgtggacattgccagaggctggctccaatc
ttggaagaagctgctgtctcattccagaatgatcccgatatcatcatcgccaaactggat
gcaactgtaaatgatatcccaaagaagtttaaggttgaaggtttcccaactatgtatttt
aaaccggcaaacggggagcttgtggaatatggaggcgatgcaaccaaggaggctatcatt
gattttattaaggagaagcgtgacaagagtatccaagaagggtccgcaagagatgagctt
tga

DBGET integrated database retrieval system