KEGG   Vitis vinifera (wine grape): 100266446Help
Entry
100266446         CDS       T01084                                 

Definition
(RefSeq) protein disulfide-isomerase-like
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100266446
Enzymes [BR:vvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100266446
Exosome [BR:vvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100266446
  Exosomal proteins of colorectal cancer cells
   100266446
  Exosomal proteins of bladder cancer cells
   100266446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 494 aa AA seqDB search
MECKCLFSVLVLFSSLLALCTVPISAVEGEFVVTLDYSNFTETVAKQDFIVVEFYAPWCG
HCQQLAPEYEKAASVLSSHDPPIILAKVNGDDAANRQLGQKFDIKGFPTLFIVKDGGKKV
QEYNGPPDADGIVNYLKRQLGPASTEIKSSEDAATFIDEKGVAIVGVFPDFSGEEFDNFI
SIAENLRSDYVFGHTLDAKLLPRGESSVKGPIVRLFKPFDELYVDFQDFEVDALEKFVKE
ASMPLVTIFDSDPSGHGYVAKFFDLPNDKVMLVVEFNSEEFDAFNSKYRDAAELYKGKNL
GFLLGDVNVSEGAVEYYGLKADQTPLIIIDNNDLDTRYFEAKIKPDQIAPWLEEYLDGRL
KPFIKSQPIPETNDGPVKVAVFETLEEIVFNSGKNVLIEFYAPWCGHCQRLAPILEEAAV
SFQNDPDIIIAKLDATVNDIPKKFKVEGFPTMYFKPANGELVEYGGDATKEAIIDFIKEK
RDKSIQEGSARDEL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggagtgcaagtgtttgttctccgtcttagtgttgttttcttctctactggctttgtgt
acagtgcccatctctgcagttgaaggagagtttgttgtgactttggattattccaacttc
actgaaactgtcgccaagcaagacttcattgttgttgagttctatgctccatggtgtggg
cactgtcagcaactcgctccagagtatgaaaaagctgcgtccgtattgagtagccatgat
cctccaatcattctggccaaagttaatggagatgatgcagcaaacagacaactcggacag
aagtttgacatcaaaggtttccccaccctctttattgtgaaagatggaggaaagaaagtt
caagaatataacggccctcccgacgctgatgggatagtaaattatctaaaaagacaactt
ggtcctgcatccactgaaataaaatcttctgaggatgctgcaactttcatagatgagaaa
ggggtcgccattgttggagtgtttccagatttctcaggagaagaatttgacaacttcatt
agtatagctgaaaatctgcgttctgactatgtatttgggcacactttggacgccaagctt
cttcctcggggtgaatcatcagtcaaggggccaattgtgagactgtttaagccatttgat
gagctctatgttgatttccaggattttgaagtagatgctttggaaaagtttgttaaagaa
gcttctatgcctttggtcaccattttcgattctgatccaagtggccatggttatgttgct
aagttcttcgacctacctaatgacaaggtcatgctggtcgtggagttcaatagtgaggag
tttgatgctttcaactcgaagtatcgtgatgctgccgagctctacaaaggaaagaacttg
ggctttctattgggtgatgtcaacgttagtgaaggtgctgttgagtattacgggctgaag
gcagatcaaacacctctgatcatcatagataacaatgacctggacaccagatattttgaa
gccaagatcaagcctgatcaaattgcaccctggttggaggaatacttggatggcagattg
aagccattcatcaagtcgcagcctattcctgaaactaatgacggacccgtgaaagtggct
gtttttgaaacactggaggagattgtgttcaactctggaaagaacgttctcatagaattt
tatgcaccttggtgtggacattgccagaggctggctccaatcttggaagaagctgctgtc
tcattccagaatgatcccgatatcatcatcgccaaactggatgcaactgtaaatgatatc
ccaaagaagtttaaggttgaaggtttcccaactatgtattttaaaccggcaaacggggag
cttgtggaatatggaggcgatgcaaccaaggaggctatcattgattttattaaggagaag
cgtgacaagagtatccaagaagggtccgcaagagatgagctttga

DBGET integrated database retrieval system