KEGG   Vitis vinifera (wine grape): 100266475Help
Entry
100266475         CDS       T01084                                 

Definition
nuclear pore complex protein Nup205-like
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100266475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 1934 aa AA seqDB search
MVSPKQLLSIIESSLLGPSPPTPAQWVELIHAIRSSLSSLQSLLSFPPPKPSDRAQVQSK
EVRLPDSPPISLDDQDVQIALKLSDDLHLNEIDCVRLLVSANQEWGLMGREPLEILRLAE
GLWYTERRDLITALYTLLRAVVLDQGLEADLVVDIQKYLEDLINTGLRQRLISLMKELNR
EEPAGLGGPHSERYVLDSRGALVERRAVVFRERLILGHCLVLSVLVVRTSPKDVKDLFST
LKDCAAELNGSSDTIKYQITFSILFSLVIAFISDALGTVPDKASVLCRDATFRREFQEIV
IASGNDPIAEGFVDVIRLAWAAHLMLVQDATVATETVSSASSNDLGYICSCLEVIFSNNV
FQFLLDKALQTAAYQNDDEDMIYVYNAYLHKMITCFLSHPIARDKVIEVERLLLRLQGRR
VYSDVEDEVIWTKAKDKRFSVKSLYKDLDPERREEFPANIIWNSLVPPRVKETKEKAMSV
LSPYRMVGSHDFMHDNNSNSQKAVEMGSQPFVSLLEFVSEVYQKEPELLSGNDVLWTFVN
FAGEDHTNFQTLVAFLKMLGTLASSQEGALKVFELLQGKTFRSVGWSTLFDCLSIYEEKF
KQALQSPGAILPEFQEGDAKALVAYLNVLQKVMQNGNPVERKNWFPDIEPLFKLLSYENV
PPYLKGALRNAITTFIQVSPALKDTIWSYLEQYDLPVVVGPNLGNNAQPMASQIYDMRFE
LNEIEARREQYPSTISFLKLLNALIAEERDVSDRGRRAYADPCEKWQLVVACLQHFRMIL
SMYDIRDGDIDNAGDQPQLSAVAQSAPLQMQLPVVELLKDFMSGKTIFRNIMGILLPGVN
SIINERTNQIYGQLLEKAVELSLEIIILVFEKDVLLSDFWRPLYQPLDVILAQDHNQIVA
LLEYVRYDFRPQIQKLSIKIMSIFGCSRMVGLVQLLLKSNAASFLIEDYAACLESVSVES
QIIENSNDDLGVLIMQLLIDNISRPAPNITHLLLKFDLDTSIERTILQPKFHYSCLKVIL
DILDKLFKPDVNALLHEFGFQLLYELCLDPLTSGPTMDLLSNKKYQFFVKHLDTIGIAPL
PKRNINQALRISSLHQRAWLLKLLAVELHAGDMVNSTHRDACQSILGHIFGPDVVDFTTD
HSTSHAYSVHNSAADVGTRTISKSKVLELLEVVQFRSPDTTMKYSQVVSNMKYDLLAEDI
LGNPTTSGKNNVYYYSERGDRLIDLTTFRDKLWQKCNFMNPQLSFFGSEVELNDVRETIQ
QLLRWGWKYNKNLEEQAAQLHMLIGWSQVVEVSASRRLSHLENRAEILFQLLDASLTASA
SPDCSLKMAVTLCQVALTCMAKLRDERFLCPGGLNSDSVTCLDIITVKQLSNGACHSILF
KLIVAILRHESSEALRRRQYALLLSYFQYCRHMLDLDVPTAVLRLLLDEHDGEDLDLLKI
DKEQAELAQANFSILRKEAQAILDLVIKDATQGSESGKTISLYVLDALICIDHERFFLNQ
LQSRGFLRSCLMNISNISLQDGGRSLDSLQRTCTLEAELALVLRISHKYGKSGAQILFSM
GALEHIASCKVVNFQMKGSFRRFETKLRRDAAVNIDKQQTIIAPILRLVFSLTSLVDTSD
FFEVKNKIVREVIDFVKGHQLLFDQVIQEDVLEADELTMEQINLVVGILSKVWPYEESDE
YGFVQGLFGMMRSLFSHDLESRTPTQPVQSLDQRKSELNIFRLCFSLSSYLYFLVTKKSL
RLQVLDGPTDYHAPGRLQQPTLTLLVYLLNSVTTALERAAEEKSLLLNKIQDINELSRQE
VDEIINMCVRQDCVSSSDNTQRRRYIAMVEMCQVAGNRDQLITLLLPLAEHVLNVILIHF
QDGSITPGTSATTKAITFGDKFDNGQDISVFCGKLIPTLERLELLSEDKVGHNLKVFRRL
VSSLKELGIQKLGA
NT seq 5805 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctcccaagcaactgctctctataatcgaatcatctcttttgggtccctctccg
ccaacgcctgcccaatgggtcgagctcatccatgccattcgcagttctctctcctctctt
cagtccctcctctcctttccccctccgaagccgtcagatcgggctcaggtgcaatcgaag
gaagttaggcttccagattcgccaccgatttcgcttgatgatcaggatgtccagattgct
ctgaaattgagtgatgatctccatctcaatgagattgattgtgtccgtctgcttgtttct
gccaatcaggagtggggtttaatgggtcgagaaccattagaaattttgcgtcttgcagag
ggactctggtatacagagagaagagatctaataacagctctatacacactgttaagggct
gttgtacttgaccaggggcttgaagctgatcttgtggttgacattcagaagtatttggaa
gatcttatcaatactggtcttagacagcggttgatttctcttatgaaggaactcaatcgg
gaagaaccagccggtttgggtgggccccactctgaacgctatgttcttgattctagaggt
gctcttgtggaacggagagcagtggtttttcgggaaagactcatacttggtcattgcctc
gtcctttctgttctggttgtgcgcacaagtccaaaagatgtaaaagacttgttttccact
ttaaaagattgtgcagctgagcttaatggcagcagtgataccataaaatatcagattaca
tttagtattcttttttctcttgttatcgcattcatatcagatgctttggggacagtacct
gataaagcatcagtcctgtgccgtgatgctacttttagacgtgaattccaggaaattgtg
attgcttctggaaatgatccaattgccgagggctttgttgatgtcataagacttgcttgg
gctgcacatttgatgttagtacaagatgcaactgttgcaacagagacagtttcaagtgct
tcatccaatgatttgggatacatctgttcatgcttggaagtcattttctctaacaatgtt
ttccagtttttgctggacaaagcccttcaaactgctgcctaccagaatgatgatgaggat
atgatctatgtctacaacgcttatttgcacaagatgattacatgcttcttatctcatccc
attgctagagacaaggtaattgaggtggagcgccttcttttgaggttgcaagggaggaga
gtttacagtgatgtggaagatgaagtaatttggactaaggcaaaggacaaaagattctca
gttaagtctctttacaaggacttggacccggaaagacgtgaagaatttcctgcaaatatc
atttggaattctttggtgccgccgagggtaaaagaaacaaaggagaaggctatgagtgtc
cttagtccttaccgtatggttggatcacatgatttcatgcatgataacaactcaaactct
caaaaggctgttgaaatgggttctcaaccatttgtctctctcttggagtttgtgagcgaa
gtttatcagaaggaaccagagctgttatctggcaatgatgtattgtggacctttgtaaac
tttgctggagaggatcatactaactttcaaacacttgtggctttcttaaaaatgctgggt
accttggcttctagtcaagaaggtgctttgaaggttttcgagttgcttcagggaaagacg
ttccgctctgttgggtggagcactttgtttgattgtttatcaatttacgaagagaagttc
aaacaggcccttcaaagcccaggggccattttgccggagtttcaagaaggggatgcaaag
gcacttgttgcatatttgaatgttcttcaaaaggttatgcaaaatggaaatcctgttgaa
aggaagaactggtttcctgatattgaaccattattcaagcttctcagctatgaaaatgtg
cctccttatttgaagggtgctttgcggaatgccattactactttcattcaagtctctcct
gctctgaaagataccatttggagctatcttgaacagtatgatctgccagtagttgttggg
cctaatttagggaataatgcacaacccatggcatcacagatttatgacatgcgatttgag
ttgaatgagatagaagcaagacgagaacaatatccttcaacaatatctttccttaagctg
ttaaatgctcttattgcagaagaaagagatgtcagtgatagagggcgtagagcatatgca
gatccttgtgagaagtggcagttagtagttgcatgtcttcaacattttcgaatgatactg
agcatgtatgatataagggatggggatattgacaatgctggtgaccaaccacagctttca
gcagtggcacaatcagccccacttcaaatgcagctccctgttgtagagttgctcaaagac
ttcatgagtggaaaaaccattttccgaaacatcatgggtatacttttgccaggagtcaat
tccatcatcaatgagcgtactaatcaaatctatggacaacttcttgagaaggctgtggaa
ctttctttagaaattatcatccttgttttcgaaaaggatgtactcctttctgatttctgg
cgtcctttataccagcctttggatgttatacttgctcaagatcacaatcaaattgtagct
ttgttggaatacgtcagatatgattttcgaccacaaattcagaagctctctatcaaaatc
atgagtattttcgggtgttctcgcatggttgggctcgtacagctactgttaaaatccaat
gctgccagctttctaattgaggattatgcagcctgtcttgaatcagtttctgtagaatct
cagatcatagagaacagcaatgatgatctaggtgttctcataatgcagcttctcattgat
aatatcagtcgtcctgctccaaatattacacatttacttcttaaatttgatcttgatacc
tcaatagaaaggacaatattacagccaaagtttcattacagttgtttgaaggttattctt
gatatcctggacaagctttttaagccagatgtaaatgcattgcttcatgaatttggtttc
cagctcctttatgagttatgcttggatcccttaacaagtggtcctaccatggacctgttg
agtaataaaaagtatcagttctttgtgaagcacctggacacaattggcattgctccactt
cctaaacgaaatatcaaccaggctcttcgtatcagttcccttcatcagagagcatggcta
ttgaagcttttagcagtggaactgcatgccggtgacatggttaattctactcaccgagat
gcatgtcaaagtattcttggtcatatatttgggccagatgttgtcgacttcacaactgat
catagtacatctcatgcgtattccgttcataatagtgctgcagatgttggaactagaact
atcagtaagagtaaggtgctggagctgcttgaagttgtccagtttagatctcctgatact
acaatgaagtattctcaggttgtttcgaacatgaaatatgacttgctggcagaagacata
cttgggaatccaacaacttctggaaaaaataatgtctactattattcagagcgtggtgac
cgcctgattgaccttaccacattccgagacaaactttggcagaaatgcaacttcatgaat
ccccagttaagcttctttggcagtgaagttgagctaaatgatgtaagagaaacaattcaa
caactgctgagatggggatggaaatacaataagaaccttgaggaacaagccgcacaactt
catatgttaattggctggtctcaagttgttgaggtctctgcatcgagaagactttctcat
cttgaaaatcgagctgaaattttgttccaattgcttgatgcctctttgactgcatcagct
tctccagactgctcattgaaaatggcagtgacattgtgccaggttgcacttacatgcatg
gccaagctacgtgatgaaagatttttgtgccctggtggtttaaattctgatagtgttaca
tgtcttgatattatcacggtgaaacaattatcaaatggggcttgccactcaatattgttt
aagcttattgttgcaattctaagacatgaatcatcagaagctttgagaagacgccaatat
gctttgcttcttagttacttccagtactgtcggcatatgcttgatctggatgttccaaca
gcagttctccgcttgttgcttgatgaacatgatggtgaagatcttgatctcctgaagatt
gacaaagaacaggctgaactagcacaggcaaatttttctattctaaggaaagaggctcaa
gccatccttgatttggtaataaaagatgcaactcaaggaagtgaatctggaaagaccata
tcgctttatgttctggatgcattaatttgtattgatcacgagagatttttcttaaaccaa
cttcagagtagaggttttttgcgatcttgcttaatgaacatcagtaatatctcccttcag
gatggtgggcgttcattagactcattgcagcgaacatgtactctcgaggccgaacttgct
ttagtgttgagaattagtcacaaatatgggaaatcaggggcccagattctattttccatg
ggtgctttagagcatattgcttcatgcaaggtggttaattttcaaatgaagggaagtttt
cggcggtttgagactaaacttagaagagatgcagctgtgaatattgataaacaacaaaca
attatagctcctatacttagattggtgttttctctgacttcattggttgatacatctgat
ttttttgaggtgaagaataaaattgtccgtgaagtcatagattttgtcaaagggcatcaa
ctgctctttgaccaagttattcaagaagatgttttggaagctgatgaattaacaatggag
caaatcaatcttgttgttggtatacttagcaaggtttggccatatgaggagagtgatgag
tatggttttgttcaagggctttttggtatgatgcgttctctcttctcacatgatctggag
tctcgtactcctactcagccagttcaatctcttgatcagaggaagtctgaattgaacata
ttccgattatgctttagcctgagctcctatctatattttcttgttacaaagaaatccctg
agactgcaggttttggatggtcctactgattaccatgcacctggtagacttcagcagccc
acattgactttacttgtttatcttcttaattctgtaacaactgccctagaaagagctgca
gaggaaaaatccttactgcttaacaagattcaagacataaatgaactatcaagacaagag
gtggatgaaattatcaatatgtgcgttcgacaagattgtgtttcatcatctgacaataca
cagagaaggaggtatatagcaatggtggaaatgtgccaggttgcaggcaatagggatcag
ctaattaccctattgcttcctcttgcagagcatgtgctgaatgtaatccttatccatttc
caggatggctctattacccctggtacaagtgcaaccacaaaagcaattacattcggtgac
aaatttgacaatgggcaagacatatcagtgttctgtgggaagctgattccaacattagaa
agacttgaattgcttagtgaggataaagtggggcacaacctgaaggtgttccgcagactg
gtgagttcactcaaggaattggggattcagaagttgggtgcatga

DBGET integrated database retrieval system