KEGG   Vitis vinifera (wine grape): 100266475Help
Entry
100266475         CDS       T01084                                 

Definition
(RefSeq) nuclear pore complex protein NUP205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
vvi  Vitis vinifera (wine grape)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100266475
Messenger RNA biogenesis [BR:vvi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100266475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 1889 aa AA seqDB search
MVSPKQLLSIIESSLLGPSPPTPAQWVELIHAIRSSLSSLQSLLSFPPPKPSDRAQVQSK
EVRLPDSPPISLDDQDVQIALKLSDDLHLNEIDCVRLLVSANQEWGLMGREPLEILRLAE
GLWYTERRDLITALYTLLRAVVLDQGLEADLVVDIQKYLEDLINTGLRQRLISLMKELNR
EEPAGLGGPHSERYVLDSRGALVERRAVVFRERLILGHCLVLSVLVVRTSPKDVKDLFST
LKDCAAELNGSSDTIKYQITFSILFSLVIAFISDALGTVPDKASVLCRDATFRREFQEIV
IASGNDPIAEGFVDVIRLAWAAHLMLVQDATVATETVSSASSNDLGYICSCLEVIFSNNV
FQFLLDKALQTAAYQNDDEDMIYVYNAYLHKMITCFLSHPIARDKVKETKEKAMSVLSPY
RMVGSHDFMHDNNSNSQKAVEMGSQPFVSLLEFVSEVYQKEPELLSGNDVLWTFVNFAGE
DHTNFQTLVAFLKMLGTLASSQEGALKVFELLQGKTFRSVGWSTLFDCLSIYEEKFKQAL
QSPGAILPEFQEGDAKALVAYLNVLQKVMQNGNPVERKNWFPDIEPLFKLLSYENVPPYL
KGALRNAITTFIQVSPALKDTIWSYLEQYDLPVVVGPNLGNNAQPMASQIYDMRFELNEI
EARREQYPSTISFLKLLNALIAEERDVSDRGRRFIGIFRFIYDHVFGPFPQRAYADPCEK
WQLVVACLQHFRMILSMYDIRDGDIDNAGDQPQLSAVAQSAPLQMQLPVVELLKDFMSGK
TIFRNIMGILLPGVNSIINERTNQIYGQLLEKAVELSLEIIILVFEKDVLLSDFWRPLYQ
PLDVILAQDHNQIVALLEYVRYDFRPQIQKLSIKIMSIFGSRMVGLVQLLLKSNAASFLI
EDYAACLESVSVESQIIENSNDDLGVLIMQLLIDNISRPAPNITHLLLKFDLDTSIERTI
LQPKFHYSCLKVILDILDKLFKPDVNALLHEFGFQLLYELCLDPLTSGPTMDLLSNKKYQ
FFVKHLDTIGIAPLPKRNINQALRISSLHQRAWLLKLLAVELHAGDMVNSTHRDACQSIL
GHIFGPDVVDFTTDHSTSHAYSVHNSAADVGTRTISKSKVLELLEVVQFRSPDTTMKYSQ
VVSNMKYDLLAEDILGNPTTSGKNNVYYYSERGDRLIDLTTFRDKLWQKCNFMNPQLSFF
GSEVELNDVRETIQQLLRWGWKYNKNLEEQAAQLHMLIGWSQVVEVSASRRLSHLENRAE
ILFQLLDASLTASASPDCSLKMAVTLCQVALTCMAKLRDERFLCPGGLNSDSVTCLDIIT
VKQLSNGACHSILFKLIVAILRHESSEALRRRQYALLLSYFQYCRHMLDLDVPTAVLRLL
LDEHDGEDLDLLKIDKEQAELAQANFSILRKEAQAILDLVIKDATQGSESGKTISLYVLD
ALICIDHERFFLNQLQSRGFLRSCLMNISNISLQDGGRSLDSLQRTCTLEAELALVLRIS
HKYGKSGAQILFSMGALEHIASCKVVNFQMKGSFRRFETKLRRDAAVNIDKQQTIIAPIL
RLVFSLTSLVDTSDFFEVKNKIVREVIDFVKGHQLLFDQVIQEDVLEADELTMEQINLVV
GILSKVWPYEESDEYGFVQGLFGMMRSLFSHDLESRTPTQPVQSLDKQRKSELNIFRLCF
SLSSYLYFLVTKKSLRLQVLDGPTDYHAPGRLQQPTLTLLVYLLNSVTTALERAAEEKSL
LLNKIQDINELSRQEVDEIINMCVRQDCVSSSDNTQRRRYIAMVEMCQVAGNRDQLITLL
LPLAEHVLNVILIHFQDGSITPGTSATTKAITFGDKFDNGQDISVFCGKLIPTLERLELL
SEDKVGHNLKVFRRLVSSLKELGIQKLGA
NT seq 5670 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctcccaagcaactgctctctataatcgaatcatctcttttgggtccctctccg
ccaacgcctgcccaatgggtcgagctcatccatgccattcgcagttctctctcctctctt
cagtccctcctctcctttccccctccgaagccgtcagatcgggctcaggtgcaatcgaag
gaagttaggcttccagattcgccaccgatttcgcttgatgatcaggatgtccagattgct
ctgaaattgagtgatgatctccatctcaatgagattgattgtgtccgtctgcttgtttct
gccaatcaggagtggggtttaatgggtcgagaaccattagaaattttgcgtcttgcagag
ggactctggtatacagagagaagagatctaataacagctctatacacactgttaagggct
gttgtacttgaccaggggcttgaagctgatcttgtggttgacattcagaagtatttggaa
gatcttatcaatactggtcttagacagcggttgatttctcttatgaaggaactcaatcgg
gaagaaccagccggtttgggtgggccccactctgaacgctatgttcttgattctagaggt
gctcttgtggaacggagagcagtggtttttcgggaaagactcatacttggtcattgcctc
gtcctttctgttctggttgtgcgcacaagtccaaaagatgtaaaagacttgttttccact
ttaaaagattgtgcagctgagcttaatggcagcagtgataccataaaatatcagattaca
tttagtattcttttttctcttgttatcgcattcatatcagatgctttggggacagtacct
gataaagcatcagtcctgtgccgtgatgctacttttagacgtgaattccaggaaattgtg
attgcttctggaaatgatccaattgccgagggctttgttgatgtcataagacttgcttgg
gctgcacatttgatgttagtacaagatgcaactgttgcaacagagacagtttcaagtgct
tcatccaatgatttgggatacatctgttcatgcttggaagtcattttctctaacaatgtt
ttccagtttttgctggacaaagcccttcaaactgctgcctaccagaatgatgatgaggat
atgatctatgtctacaacgcttatttgcacaagatgattacatgcttcttatctcatccc
attgctagagacaaggtaaaagaaacaaaggagaaggctatgagtgtccttagtccttac
cgtatggttggatcacatgatttcatgcatgataacaactcaaactctcaaaaggctgtt
gaaatgggttctcaaccatttgtctctctcttggagtttgtgagcgaagtttatcagaag
gaaccagagctgttatctggcaatgatgtattgtggacctttgtaaactttgctggagag
gatcatactaactttcaaacacttgtggctttcttaaaaatgctgggtaccttggcttct
agtcaagaaggtgctttgaaggttttcgagttgcttcagggaaagacgttccgctctgtt
gggtggagcactttgtttgattgtttatcaatttacgaagagaagttcaaacaggccctt
caaagcccaggggccattttgccggagtttcaagaaggggatgcaaaggcacttgttgca
tatttgaatgttcttcaaaaggttatgcaaaatggaaatcctgttgaaaggaagaactgg
tttcctgatattgaaccattattcaagcttctcagctatgaaaatgtgcctccttatttg
aagggtgctttgcggaatgccattactactttcattcaagtctctcctgctctgaaagat
accatttggagctatcttgaacagtatgatctgccagtagttgttgggcctaatttaggg
aataatgcacaacccatggcatcacagatttatgacatgcgatttgagttgaatgagata
gaagcaagacgagaacaatatccttcaacaatatctttccttaagctgttaaatgctctt
attgcagaagaaagagatgtcagtgatagagggcgtagattcattggtatctttaggttc
atatatgatcacgtgtttgggccattccctcaaagagcatatgcagatccttgtgagaag
tggcagttagtagttgcatgtcttcaacattttcgaatgatactgagcatgtatgatata
agggatggggatattgacaatgctggtgaccaaccacagctttcagcagtggcacaatca
gccccacttcaaatgcagctccctgttgtagagttgctcaaagacttcatgagtggaaaa
accattttccgaaacatcatgggtatacttttgccaggagtcaattccatcatcaatgag
cgtactaatcaaatctatggacaacttcttgagaaggctgtggaactttctttagaaatt
atcatccttgttttcgaaaaggatgtactcctttctgatttctggcgtcctttataccag
cctttggatgttatacttgctcaagatcacaatcaaattgtagctttgttggaatacgtc
agatatgattttcgaccacaaattcagaagctctctatcaaaatcatgagtattttcggt
tctcgcatggttgggctcgtacagctactgttaaaatccaatgctgccagctttctaatt
gaggattatgcagcctgtcttgaatcagtttctgtagaatctcagatcatagagaacagc
aatgatgatctaggtgttctcataatgcagcttctcattgataatatcagtcgtcctgct
ccaaatattacacatttacttcttaaatttgatcttgatacctcaatagaaaggacaata
ttacagccaaagtttcattacagttgtttgaaggttattcttgatatcctggacaagctt
tttaagccagatgtaaatgcattgcttcatgaatttggtttccagctcctttatgagtta
tgcttggatcccttaacaagtggtcctaccatggacctgttgagtaataaaaagtatcag
ttctttgtgaagcacctggacacaattggcattgctccacttcctaaacgaaatatcaac
caggctcttcgtatcagttcccttcatcagagagcatggctattgaagcttttagcagtg
gaactgcatgccggtgacatggttaattctactcaccgagatgcatgtcaaagtattctt
ggtcatatatttgggccagatgttgtcgacttcacaactgatcatagtacatctcatgcg
tattccgttcataatagtgctgcagatgttggaactagaactatcagtaagagtaaggtg
ctggagctgcttgaagttgtccagtttagatctcctgatactacaatgaagtattctcag
gttgtttcgaacatgaaatatgacttgctggcagaagacatacttgggaatccaacaact
tctggaaaaaataatgtctactattattcagagcgtggtgaccgcctgattgaccttacc
acattccgagacaaactttggcagaaatgcaacttcatgaatccccagttaagcttcttt
ggcagtgaagttgagctaaatgatgtaagagaaacaattcaacaactgctgagatgggga
tggaaatacaataagaaccttgaggaacaagccgcacaacttcatatgttaattggctgg
tctcaagttgttgaggtctctgcatcgagaagactttctcatcttgaaaatcgagctgaa
attttgttccaattgcttgatgcctctttgactgcatcagcttctccagactgctcattg
aaaatggcagtgacattgtgccaggttgcacttacatgcatggccaagctacgtgatgaa
agatttttgtgccctggtggtttaaattctgatagtgttacatgtcttgatattatcacg
gtgaaacaattatcaaatggggcttgccactcaatattgtttaagcttattgttgcaatt
ctaagacatgaatcatcagaagctttgagaagacgccaatatgctttgcttcttagttac
ttccagtactgtcggcatatgcttgatctggatgttccaacagcagttctccgcttgttg
cttgatgaacatgatggtgaagatcttgatctcctgaagattgacaaagaacaggctgaa
ctagcacaggcaaatttttctattctaaggaaagaggctcaagccatccttgatttggta
ataaaagatgcaactcaaggaagtgaatctggaaagaccatatcgctttatgttctggat
gcattaatttgtattgatcacgagagatttttcttaaaccaacttcagagtagaggtttt
ttgcgatcttgcttaatgaacatcagtaatatctcccttcaggatggtgggcgttcatta
gactcattgcagcgaacatgtactctcgaggccgaacttgctttagtgttgagaattagt
cacaaatatgggaaatcaggggcccagattctattttccatgggtgctttagagcatatt
gcttcatgcaaggtggttaattttcaaatgaagggaagttttcggcggtttgagactaaa
cttagaagagatgcagctgtgaatattgataaacaacaaacaattatagctcctatactt
agattggtgttttctctgacttcattggttgatacatctgatttttttgaggtgaagaat
aaaattgtccgtgaagtcatagattttgtcaaagggcatcaactgctctttgaccaagtt
attcaagaagatgttttggaagctgatgaattaacaatggagcaaatcaatcttgttgtt
ggtatacttagcaaggtttggccatatgaggagagtgatgagtatggttttgttcaaggg
ctttttggtatgatgcgttctctcttctcacatgatctggagtctcgtactcctactcag
ccagttcaatctcttgataagcagaggaagtctgaattgaacatattccgattatgcttt
agcctgagctcctatctatattttcttgttacaaagaaatccctgagactgcaggttttg
gatggtcctactgattaccatgcacctggtagacttcagcagcccacattgactttactt
gtttatcttcttaattctgtaacaactgccctagaaagagctgcagaggaaaaatcctta
ctgcttaacaagattcaagacataaatgaactatcaagacaagaggtggatgaaattatc
aatatgtgcgttcgacaagattgtgtttcatcatctgacaatacacagagaaggaggtat
atagcaatggtggaaatgtgccaggttgcaggcaatagggatcagctaattaccctattg
cttcctcttgcagagcatgtgctgaatgtaatccttatccatttccaggatggctctatt
acccctggtacaagtgcaaccacaaaagcaattacattcggtgacaaatttgacaatggg
caagacatatcagtgttctgtgggaagctgattccaacattagaaagacttgaattgctt
agtgaggataaagtggggcacaacctgaaggtgttccgcagactggtgagttcactcaag
gaattggggattcagaagttgggtgcatga

DBGET integrated database retrieval system