KEGG   Vitis vinifera (wine grape): 100266796Help
Entry
100266796         CDS       T01084                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12-like
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
vvi  Vitis vinifera (wine grape)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1116 aa AA seqDB search
MTVMTPASIEREDEEMLVPHTDLADGHQPMEVVAQEETTSTVENQPVEDPPTSRFTWRIE
NFSRLNTKKHYSENFIVGGYKWRVLIFPKGNNVEHLSMYLDVADSSSLPYGWSRYAQFSL
AVVNQIHNKYTVRKDTQHQFNARESDWGFTSFMPLSELYDPGRGFLVSDTCIVEAEVAVR
RVVDYWTYDSKKETGYVGLKNQGATCYMNSLLQTLYHIPYFRKAVYHMPTTENDMPSGSI
PLALQSLFYKLQYSDSSVATKELTKSFGWDTYDSFLQHDVQELNRVLCEKLEDKMKGTVV
EGTIQQLFEGHHMNYIECINVDYKSTRKESFYDLQLDVKGCHDVYASFDKYVEVERLEGD
NKYHAEHHGLQDARKGVLFIDFPPVLQLQLKRFEYDFMRDTMVKINDRYEFPLQLDLDRE
NGKYLSPDANRTVRNLYALHSVLVHSGGVHGGHYYAFIRPTLSDQWYKFDDERVTKEDVK
RALEEQYGGEEELPQTNPGLNNTPFKFTKYSNAYMLVYIRESDKDKIICNVDEKDIAEHL
RERLKKEQEEKEHKKKEKAESHLYTIIKVARDDDLVEHIGRDIYFDLVDHDKVRSFRIQK
QMPFNFFKEEVAKEFGIPIQFQRFWLWAKRQNHTYRPNRPLTHLEEQQSVGQLREISNKV
QNAELKLFLEVNLGPDLHPNPPPEKTKDDILLFFKLYDPEKEELNYVGRLFVKSTGKPVE
ILSKLNEMVGYAPDEEIELYEEIKFDPSVMCEPIDKKFTFRASQLEDGDIICFQKTPPIE
SGESFRYPDVPSFLEYVHNRQVVHFRSLEKPKEDDFCLEMSKLFTYDDVVERVARQLGLD
DPSKIRLTSHNCYSQQPKPQPIKYRGVDHLSDMLVHYNLISDVLYYEVLDIPLPELQGLK
TLKVAFHHAEKEEVVSHSIRLPKQSTVGDVINALKTKVELSHPNAEVRLLEVFYHKIYKV
FPSNEKIENINDQYWTLRAEEIPEEEKNLGPQDRLIHVYHFTKDTAQNQMQIQNFGEPFF
LVIHEGETLAEVKVRIQKKLLVPEEEFAKWRFAFLSLGRPEYLQDSDIVSSRFQRRDVYG
AWEQYLGLEHSDTAPKRAYAANQNRHTFEKPVKIYN
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgatgactcctgcttctattgaacgagaggacgaggagatgctggttccccac
acagatttggccgacggccatcaacctatggaagttgttgcacaagaggaaactactagt
actgtggaaaaccagccagttgaggatcctcctacatcaaggttcacatggagaattgag
aacttttctaggttgaatacaaagaagcactattccgaaaatttcattgtgggcggctat
aagtggcgggtgcttatttttccaaagggaaacaatgttgaacatttgtctatgtacttg
gatgttgcggattcatcaagtttgccctatgggtggagtagatatgcacaattcagcttg
gctgtggtaaatcaaattcataacaaatatacagtgagaaaagacactcaacaccagttt
aatgcacgagaaagtgattggggtttcacttcttttatgcctcttagtgaactatacgat
ccaggtaggggttttcttgtgagtgatacatgtatagttgaagcagaggttgctgtccgc
agagttgtggattactggacatatgactcaaaaaaggaaactggttatgttggacttaag
aaccaaggagcaacttgttacatgaactctctcctccaaactctctatcatattccctac
tttagaaaggctgtgtaccatatgccaacgactgagaatgatatgccatctggaagcatt
cctttggctttgcagagtttattctataagcttcaatacagtgacagcagcgttgcaacg
aaagagttgacaaaatcgtttggttgggacacatatgattctttcttgcagcatgatgtg
caagaactcaatagggtcctctgtgaaaagcttgaagacaaaatgaagggaactgttgtg
gagggcactatacagcagttatttgaagggcaccatatgaactacattgaatgcatcaat
gtggactacaaatctacaaggaaggagtcattttatgaccttcagctggatgtcaaaggt
tgtcatgatgtttatgcttcttttgataagtacgtagaagttgagcgcctagaaggggat
aacaaatatcatgctgagcaccatggattgcaggatgctaggaagggtgtcttattcatt
gacttccctcctgtccttcaacttcagctgaagcgatttgaatatgattttatgcgggac
actatggtaaagataaatgatcgctatgagttccctctgcaacttgatcttgatcgagag
aatggcaaatatttatctcctgatgccaataggactgttcgcaacctttacgcccttcac
agtgttctagttcacagtggcggagtgcatggtggacattattatgcctttataagaccc
accctttctgatcagtggtataaatttgatgatgaaagggtgacaaaagaagacgtgaag
agggctttggaggagcaatatggtggtgaagaagagctgccccagacaaatcctggattg
aataacaccccctttaaatttacgaagtattcaaatgcatacatgctggtgtatatacgt
gaaagtgacaaggacaaaataatttgcaatgtggatgagaaggacattgctgaacatctc
cgggagaggttgaagaaagaacaagaagaaaaagagcacaagaaaaaggaaaaagccgag
tcacatctttataccattattaaggttgcacgagatgatgaccttgtagaacatattgga
agggatatatattttgatcttgtggatcatgacaaagttagaagttttcgtatccagaag
cagatgcctttcaactttttcaaggaggaggtagctaaagagtttggtataccaattcaa
tttcagcgtttttggctgtgggcaaagcgccaaaaccacacatatcgtcctaatcggcca
ttgacacatctagaagaacaacaatctgttggacagttaagggagatatcaaataaggtt
caaaatgcagaactaaagttgttcttggaagtaaatcttgggccggatttacacccaaac
cctccacctgagaagacaaaggatgatattttgcttttcttcaagctttatgatcctgag
aaggaagagctaaattatgttggaaggctttttgtgaagagtactggtaagcctgtagaa
attttgtcaaaactgaatgaaatggttggttatgctcctgatgaagagattgaactctat
gaggaaatcaagtttgatcctagtgtcatgtgtgaacccattgataagaaattcacattc
cgagctagccagcttgaagatggtgatatcatttgctttcaaaaaacacctccaattgaa
agtggtgaatcattccgctatccagatgttccttcatttttagaatacgtgcacaatcgc
caagttgttcattttcggtccctagaaaaacccaaggaagatgatttttgtcttgagatg
tcaaagctttttacttatgatgacgtggtagaaagagtagctcgtcagcttggtttggat
gatccatccaaaatcaggctcacatctcacaactgttactctcagcaaccaaaaccccag
ccaattaagtaccgtggggtggaccatttgtctgacatgctggttcactacaatctgatt
tcggatgtattgtactatgaagtattggacatccctcttccagaattacaaggtttaaaa
actttgaaagttgcttttcatcatgctgaaaaggaggaagttgttagtcatagtattaga
ctgccaaaacagagtacagtaggggatgtaattaatgctcttaaaacaaaggttgagctg
tctcatcctaatgctgaagttaggttgcttgaagttttctatcacaagatctataaggtt
tttccttcaaatgaaaaaattgagaacattaatgatcaatactggacactgcgtgctgaa
gagattcctgaagaagagaaaaatcttggaccacaggatcgcttgattcatgtataccac
tttacaaaagacacagctcagaaccaaatgcaaattcagaatttcggggagccttttttc
ttggtcatccatgagggtgaaactctggctgaagttaaggtgcggatacagaagaagctg
ctggttccagaggaagaatttgctaagtggaggtttgcctttctttcactaggtcgccca
gagtaccttcaagactctgacattgtctccagtcgttttcagagaagagatgtttatggt
gcttgggagcagtatcttggactagagcattctgacactgctcctaaaagggcttatgca
gctaatcagaaccgtcacacatttgagaagccggtaaaaatctacaactag

DBGET integrated database retrieval system