KEGG   Vitis vinifera (wine grape): 100267459Help
Entry
100267459         CDS       T01084                                 

Definition
magnesium-chelatase subunit chlI, chloroplastic-like
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vvi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 426 aa AA seqDB search
MAGIFGTSSSSTAILASRPLSSTSKSSIPSLSLPLCTWRSHGKKLYGGVGVQLKKGRSQF
HVAVSNVATEINPAEKAQKLAAEESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIM
GDRGTGKSTTVRSLVDLLPEIRVVSGDPFNSDPEDPESMGMEVRESILKGELLSIVMTKI
NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVL
LDSAASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELR
VKIVEERARFDKNPKEFRDSYKAEQEKLQQQISSARSDLSSVQIDHDLRVKISKVCAELN
VDGLRGDIVTNRAAKALAALKGRDNVTAEDIATVIPNCLRHRLRKDPLESIDSGLLVIEK
FYEVFS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaatttttgggacttcttcttcttcaacggcaatcttggcttctagacctctc
tcttctacttccaagtcctccattccctctttatctctccctctttgtacatggcggagt
catggaaagaagttatatggaggggttggagttcagcttaagaaaggcagatcccagttc
catgttgctgtttccaatgttgccactgaaatcaatcctgctgaaaaggcccaaaagctt
gccgctgaagaaagccagaggccagtgtatccatttgctgctatagtaggacaagatgag
atgaagctatgccttcttctaaatgtgatagatcccaagattggaggggtgatgatcatg
ggtgataggggaacgggaaaatccactactgttaggtccctggtggatttgcttccagaa
atcagagtggtttcaggtgacccatttaactctgatccagaagatccagaatccatgggc
atggaagtcagggagagcattttgaaaggggagctactttccattgtgatgaccaaaatc
aacatggttgatttaccactgggtgcaactgaagatagagtctgtgggacaattgacatt
gaaaaggctctgacagagggtgtgaaagcttttgagcctgggcttcttgctaaagccaat
aggggaattctttatgtggatgaagttaaccttctggatgatcatttagtggatgttctt
ctggattctgctgcctcgggatggaacactgttgaaagagagggaatttcaatttcacat
cctgctcggtttattctcattggctcaggcaaccctgaggaaggggagctcaggccacag
ctacttgacagatttggaatgcatgcacaagtgggaactgtgagggatgcagagctcaga
gttaagattgtggaggagagagctcggtttgacaaaaatcccaaggaattcagggattct
tataaggccgagcaagagaagctccagcaacaaatttcctctgctaggagtgatctttcc
tctgttcagattgatcatgatctccgtgtgaaaatctccaaggtttgtgcagagctaaat
gttgatggattaagaggggacatagtgacaaatagagcagcaaaagcactggctgctctg
aagggaagagataatgtaactgcagaggatattgctactgtcattccaaactgcttaaga
caccgtcttcggaaggatcccttggagtcaattgactctggattacttgtcattgagaaa
ttctatgaggtgtttagctga

DBGET integrated database retrieval system