KEGG   Vitis vinifera (wine grape): 100267529Help
Entry
100267529         CDS       T01084                                 

Definition
bifunctional dihydrofolate reductase-thymidylate synthase-like
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vvi00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vvi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:vvi00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 524 aa AA seqDB search
MASDTVVSLPNGNANIQPDPQRTYQVVVAATRDMGIGKDGKLPWRLPSDMKIFKDITMTV
ADTVKKNAVIMGRKTWESIPLEHRPLPGRLNVVLTRSGSFDIATAENVVICGSMASALEL
LAASPYCLSIEKVFVIGGGQILREALNAPGCDAIHITEIETSFECDTFIPAIDSLVFQPW
YSSFPLVENNIRYSFMTYVRVRSSADESQIQNNGDSGLESIKFEVKKFSFLPKMIFERHE
EYIYLRLVEDIISNGVQRDDRTGTGTLSKFGCQMRFNLRKTFPLLTTKKVFWRGVVEELL
WFISGSTNAKVLQEKGIHIWDGNASRDYLDSIGLADREEGDLGPIYGFQWRHFGASYIDM
HADYTGQGFDQLLDVINKIKNNPNDRRIILSAWNPSDLKLMALPPCHMFAQFYVSHGELS
CQMYQRSADMGLGVPFNIASYALLTCMIAHVCDLVPGDFIHVIGDSHVYLTHIRPLQEQL
QKLPKPFPILKINPQKKNIDSFVAADFQLIGYDPHQKIEMKMAV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgacactgttgtgagccttcctaatggcaatgccaatatacagcctgatcca
cagaggacgtaccaagttgttgtggctgcaactcgagatatgggtattggtaaggatggg
aaactaccctggagattgccttctgacatgaaaattttcaaggacattactatgactgta
gcagatactgtgaaaaagaatgcagttataatgggtagaaaaacatgggaaagtattcct
cttgagcatcggcctctgcctggccgcctaaatgttgttctgactcgttctggaagtttt
gatattgcaactgcagagaatgttgtaatatgtggaagcatggcttctgctttggaacta
ttagctgcatctccctattgtctgtccattgaaaaagtgtttgttataggaggtggccag
atactaagggaagctctcaatgcacctggatgtgatgctatccacattacagaaattgag
acaagcttcgaatgtgacactttcatccctgctattgattccttggtatttcagccttgg
tactcatccttcccattggtggaaaacaatattcgttattctttcatgacttatgttcgt
gtgagaagttctgcagacgaatcccaaatccagaacaatggtgacagtgggttggaatcc
attaaatttgaagtaaagaagttctctttcttgcccaagatgatctttgagaggcatgag
gaatacatctatctgagattggttgaagacatcatctcaaatggtgttcaaagggatgat
aggacagggactggtactttatcaaagtttggttgccagatgcggtttaatctacgaaaa
acttttccgcttcttacaactaagaaagtattttggcgaggggttgttgaagaactgctg
tggttcatcagtggctcaacaaatgctaaggtcctacaggaaaagggaattcatatatgg
gatggcaatgcatccagggactaccttgatagtattggcttggcagacagggaagagggt
gacttgggacccatatatgggttccagtggaggcactttggtgctagctatattgacatg
catgctgactatactggccaaggatttgatcagttgttagatgttattaacaagatcaag
aataatccgaatgatcgacggattatcctctcagcttggaatccttctgatctcaaattg
atggcacttccaccctgccatatgtttgcacagttctatgtaagccatggggagttatca
tgccaaatgtaccagcgatctgctgacatgggtcttggtgtgccgtttaacattgcatct
tatgcgctcttaacatgcatgatcgctcatgtttgtgaccttgttcctggtgatttcatc
catgttattggggactctcatgtttatctgactcatatcaggcctctgcaggagcagctt
cagaagcttcctaaaccttttccaattttgaagatcaatccacagaagaagaacattgat
tcttttgtggcagctgatttccaactcataggttatgatcctcatcagaaaatagagatg
aaaatggcggtatag

DBGET integrated database retrieval system