KEGG   Vitis vinifera (wine grape): 100267821Help
Entry
100267821         CDS       T01084                                 

Definition
alcohol dehydrogenase 1-like
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    100267821
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100267821
  Lipid metabolism
   00071 Fatty acid degradation
    100267821
  Amino acid metabolism
   00350 Tyrosine metabolism
    100267821
Enzymes [BR:vvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100267821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 380 aa AA seqDB search
MSSTAGQVIRCKAAVAWEAGKPLVIEEVEVAPPQVMEVRLKILFTSLCHTDVYFWEAKGQ
TPLFPRIFGHEAGGIVESVGEGVTDLQPGDHVLPVFTGECKECRHCKSEESNMCDLLRIN
TDRGVMLSDNKSRFSINGKPIYHFVGTSTFSEYTVVHVGCVAKINPAAPLDKVCVLSCGI
STGLGATLNVAKPWKGSSVAIFGLGAVGLAAAEGARIAGASRIIGIDLNPKRFNDAKKFG
VTEFVNPKDHDKPVQEVIAEMTDGGVDRSVECTGNVNAMISAFECVHDGWGVAVLVGVPN
KDDSFKTHPVNLLNERTLKGTFFGNYKPRSDLPSVVEKYMNKELELEKFITHEVPFAEIN
KAFEYMLSGDGLRCIIRMNA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcacagctggtcaagttatacgttgcaaagccgcggtagcatgggaagcagga
aagccattggtgatagaagaagtggaagtggcgcctccacaggtcatggaggttcgtctg
aagattctcttcacctccctctgccatactgatgtttacttctgggaagccaagggacaa
acccctttatttcctcgtatatttggtcatgaggctggcgggattgtggagagcgtgggt
gagggtgtcacagatctccaacctggagaccatgttcttcctgtattcactggcgaatgc
aaggagtgccggcactgcaagtcagaggagagtaatatgtgtgacctcctcaggataaac
accgacagaggcgtgatgctcagtgataacaaatcaagattctctattaacggaaaaccc
atttaccattttgtggggacttccacatttagcgaatacactgtggttcatgttggttgc
gtcgctaagatcaaccctgctgccccactcgacaaagtttgtgttctcagttgtggaatc
tctacaggtctgggtgctacattgaatgttgcaaaaccatggaagggttcatcagtcgcc
attttcggtttaggagctgtggggcttgctgctgctgagggggctagaattgcaggcgct
tccagaatcattgggattgatctaaaccctaagagatttaatgacgcaaagaaatttggc
gtcactgagtttgtgaacccaaaggatcatgacaagcctgttcaagaggtgattgctgag
atgaccgatgggggagtggacagaagtgttgagtgtaccggaaatgtcaatgctatgata
tctgcatttgagtgtgttcatgatgggtggggtgttgctgtgctggttggtgtgccaaac
aaagatgactcgttcaaaacgcaccccgtgaatctattgaacgagaggactctgaagggc
actttctttggcaactacaaaccccgttccgaccttccttcagtggtggaaaaatacatg
aacaaggagcttgaactggagaaattcatcacacacgaagtcccttttgcagagatcaac
aaggccttcgaatatatgcttagcggggatgggcttcgatgcatcattcgcatgaatgca
taa

DBGET integrated database retrieval system