KEGG   Vitis vinifera (wine grape): 100268013Help
Entry
100268013         CDS       T01084                                 

Definition
(RefSeq) profilin-2
  KO
K05759  
profilin
Organism
vvi  Vitis vinifera (wine grape)
Brite
Cytoskeleton proteins [BR:vvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100268013
Exosome [BR:vvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100268013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 133 aa AA seqDB search
MSWQTYVDDHLMCEIDGQGQHLTAAAIVGHDGSVWAQSTSFPEFKTPEITGIMNDFAEPG
HLAPTGLYLGGTKYMVIQGEPGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV
VERLGDYLVDQGL
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacatacgtagatgaccatctgatgtgcgaaatcgacggccaaggccag
cacctcaccgccgctgccatcgtcggccacgacggcagcgtctgggcgcagagcacttct
ttcccagagttcaagactccagagatcactggtatcatgaatgattttgcagaaccaggt
cacctagcccctactggcttatacctcgggggtacaaagtatatggttattcagggagag
cctggggctgtcatccgtggaaagaagggatcaggcggcatcactataaagaagactggt
caggcactggtttttggcatctatgaggaacctgtgactccaggacaatgcaacatggtt
gttgaaaggttgggggattacctggttgatcagggcctgtag

DBGET integrated database retrieval system