KEGG   Vitis vinifera (wine grape): 100852697Help
Entry
100852697         CDS       T01084                                 

Definition
AMSH-like ubiquitin thiolesterase 2-like
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100852697
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100852697
Peptidases [BR:vvi01002]
 Metallo Peptidases
  Family M67
   100852697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 275 aa AA seqDB search
MRNQRFRIINEEKDELASVCSVDSSTSCSPFESAWPTSFMTASEHCITVHAVTKASPSPI
IYCTENAHHDKHISHIEVSDSEPGHSKSCSETAVSKKLQDVHISARLMEDFLELARDNTK
NDLETCGILGAFLKMGTFYVTTLIIPKQESTSNSCQAIKEEEIFAIQNEHSLFPVGWIHT
HPSQSCFMSSIDLHTQYSYQVMVPEAFAIVMAPTDTSRSYGIFRLSDPVGMSVLKDCPEE
GFHHHNEPADGGPIYEHCSNIYINSNLRFEIFDLR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcagagattcaggattatcaatgaggaaaaggatgagttggcatctgtttgt
tcagtggattccagcactagttgctccccatttgaatctgcttggcccacctcctttatg
accgctagtgaacattgtatcactgtgcatgctgttacaaaggcttctccttctcctata
atctactgcacagagaatgcacatcatgataaacatatttcacatatcgaagtttctgat
tcagaacctggacattcaaagtcatgcagtgagacagcagtatccaagaaactgcaagat
gtacacatatcagcacggttgatggaggattttcttgaacttgctagagacaacacaaag
aatgatctggagacttgtgggattcttggtgctttccttaaaatggggaccttctatgta
actactctgataatacccaagcaggaatcaacttccaacagttgtcaggctataaaagag
gaggagatttttgccatacaaaatgaacactccctttttcctgtaggatggatccataca
catccttctcagagttgtttcatgtcatcaatagatttgcacacgcaatactcatatcag
gtgatggtgcctgaggcttttgccattgtcatggctccaactgatacctcaaggagctat
ggcatattccggctgtctgacccagttggaatgagtgttctgaaagactgcccagaggag
ggatttcatcatcacaatgaaccagcagatgggggtcccatttatgagcactgctctaat
atttatataaattcaaatctcagatttgaaatatttgacttgcgatga

DBGET integrated database retrieval system