KEGG   Vitis vinifera (wine grape): 100854352Help
Entry
100854352         CDS       T01084                                 

Definition
(RefSeq) probable carboxylesterase SOBER1-like
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
vvi00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100854352
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100854352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 DLH Peptidase_S9 Abhydrolase_3 AXE1 Abhydrolase_6 PE-PPE FSH1 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 100854352
NCBI-ProteinID: XP_019074095
Position
Un
AA seq 475 aa AA seqDB search
MARSFVLWLHGLDDSGPANEHIKALFTSSEFRNTVWSFPSAPPIPVTCNNGAITPSWFDI
HEIPVTTDSTKDENGVLKAVKHVHAMLDKELAAGTNANNVFVCGESQGGALTLASVLLYP
RTLGGGAIFSGWVPFNSSIIEQIPPGSKKTPILWLHGMADRTVLFETGQAGQHFLEQAGV
SCEFKSYPGLGHSISNEELQDLESWIITHLQRSLESHHGRTAMDLITVSTKPIALLTITL
GSTIFFILILRPHTFSPKPDSMARSFVLWLHGLGDSGPANEPIKTLFTSPEFRNTIWKFP
SAPSNPVTCNYGSVMPSWFDIHEIPVTADSPKDENGVLKAVQNVHAMIDKELAAGTNPKN
IFVCGFSQGGALTLASVLLYPRTLGGGAVFSGWVPFNSTMIERMPADAKKTPILWSHGMA
DRTVLFEAGQAGPPFLEQAGVSCEFKAYPGLAHSISNEELRYLESWIKTRLQSSS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaagctttgttctatggcttcatgggttggatgactctggccctgccaatgaa
catatcaaggccctcttcacttcatctgagttcagaaacactgtctggtccttcccttct
gctcctcccatcccagtcacctgcaataatggtgccatcacaccttcatggtttgacatt
catgagatacctgtgacaactgattctactaaagatgaaaatggcgtgcttaaagcagtt
aagcatgtgcatgcaatgttagacaaggagcttgctgcaggcacaaatgctaataatgta
tttgtatgtggagagagtcaaggaggtgctttgaccttagcaagtgttttgctataccca
agaactctaggaggaggtgcaatctttagtggatgggttccttttaattcgtctataata
gaacaaatcccaccagggtcaaagaagacacccattctgtggttgcatggtatggctgac
agaacagtattgtttgaaactggacaagcaggtcagcatttccttgaacaagctggcgta
agttgtgagtttaagtcttatcctggtctcggccattcaataagcaatgaggagttgcaa
gacctagagtcatggatcatcactcatcttcagaggtctttagagagccaccatggaaga
acagcgatggaccttataacagtgtcaacaaaaccaattgctctccttacaatcacctta
ggtagcaccattttcttcatacttatcctccggccgcatacattttctccaaagccagac
tccatggctcgaagctttgttttgtggcttcatgggttgggtgactcaggccctgccaat
gaacccatcaagaccctcttcacttctcctgagttcagaaacaccatatggaaattccct
tctgctccttcaaacccagtcacctgcaattatggttctgtcatgccttcctggtttgac
attcatgagatacctgtgacagctgattctccaaaagatgaaaatggtgtacttaaagca
gttcagaatgtgcatgcaatgatagataaggagctagctgcaggcacaaatcctaaaaac
atatttgtatgtggattcagtcaaggaggtgccttgaccttggcaagtgttttgctatac
ccaagaactctaggaggaggtgctgtcttcagtggatgggttccttttaattcaaccatg
atagaacgaatgccagcagatgccaagaagacacctattttgtggtcacatggtatggct
gacagaacagtattgtttgaagctggacaagcaggtcctcctttccttgaacaagctggt
gtaagttgtgagtttaaggcttatcctggtctggctcattccataagcaatgaggaattg
cggtacctagaatcatggatcaaaactcgacttcagagttcttcgtag

DBGET integrated database retrieval system