KEGG   Vitis vinifera (wine grape): 100854808Help
Entry
100854808         CDS       T01084                                 

Definition
putative PAP-specific phosphatase, mitochondrial-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vvi  Vitis vinifera (wine grape)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100854808
Enzymes [BR:vvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100854808
Transfer RNA biogenesis [BR:vvi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100854808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 437 aa AA seqDB search
MSGQCSISELWGQSSLIEAALHHLPAMGLLHHCSPVPTVRFLITHRIIMPLRYSSPRLLT
VRSSLPFPTQKAKYHRELEAAVHVVERACRLCVDVKRSLLSGDGRILEKNDQTPVTVADF
GVQALISLELGKLFPSIPLVAEEDSAFLRSNNLADLVVDAVTGKAKFGDKQLTHDDVLDA
IDRGGKDAFTFGANPATYWVLDPIDGTRGFLKGCEALYVVGLALVVEGEIVLGVMGCPNW
QEDLSSTEVQEDENKPSGPGIIMVSHVGCGTWIKRFYNILDNSPNMPDCWNRSFVDQCCL
VHEARFCIPESQTWESLPLSDVKASADGISIADKEILLLPTCCGSLCKYLMVASGRASVF
FLRARSEKTIKVWDHAVGVICVHEAGGKVTDWNGSQLDIEVDQVERRVIFPSGGILVSNG
NLHDRILEMISSRLSFS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccagtgctcgatctcagagctttggggacaatcttcgctaattgaagcagct
ctacaccatcttcccgccatgggtctcctgcatcactgttctccagttcctacggttcgc
ttccttattacgcaccgtattatcatgccccttcgctactcctccccacgactcctcacc
gtaaggtccagtcttccatttccaactcagaaggccaagtatcacagagagctcgaggct
gctgtgcatgttgtggagagagcttgtcgtctttgtgttgatgtgaagaggtctcttttg
tctggtgatggacggattctggaaaagaacgaccaaacaccggtcactgttgcagatttt
ggagtgcaggccttgattagcttggagcttggaaaactatttccttccattcccttggtg
gctgaagaggactctgcattcttacgttcaaataatctggcagatcttgtggtagatgct
gtaactggtaaagctaaatttggagataaacaattgacacatgatgatgtactggatgca
attgacagaggtgggaaggatgcctttacttttggagctaatccggctacatattgggta
ctggatccaattgatggaactcggggatttctaaaaggttgtgaggccttatatgtggta
ggtttggctctcgtagttgaaggagaaattgtattaggtgttatgggctgccctaattgg
caggaagacttgtccagtactgaagttcaggaagatgaaaacaagccatctggaccaggg
atcattatggtttctcatgttggctgtggaacatggatcaagaggttttataacattctg
gataattctcccaacatgccagattgctggaatagatcctttgttgatcaatgttgctta
gttcacgaggcacgcttttgtattccagagagtcaaacttgggaatcattgccactatct
gatgtgaaagctagtgctgatggcattagtattgctgataaagaaattcttcttttgccg
acatgctgtggaagtttatgcaagtatttaatggtggcttctggtagggcatctgttttc
tttcttcgagccagatctgaaaaaactataaaggtttgggatcatgctgttggtgtgata
tgtgtgcatgaagcaggaggaaaggttaccgactggaatgggagtcaacttgacattgag
gtggatcaagttgagcgaagagttatatttccttcaggtggtatcctggtgtcaaatggc
aacttacatgaccggatcctggagatgatttcttccagactatcattttcttga

DBGET integrated database retrieval system