KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00207Help
Entry
VVMO6_00207       CDS       T01415                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVMO6_00207
   01230 Biosynthesis of amino acids
    VVMO6_00207
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VVMO6_00207
   00030 Pentose phosphate pathway
    VVMO6_00207
   00051 Fructose and mannose metabolism
    VVMO6_00207
   00052 Galactose metabolism
    VVMO6_00207
  Energy metabolism
   00680 Methane metabolism
    VVMO6_00207
Enzymes [BR:vvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VVMO6_00207
Protein phosphatases and associated proteins [BR:vvm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VVMO6_00207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:229526..230488
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVYGIYDGYLGLYEGRIKQLDRSSVSD
VINRGGTFLGSARFPEFKEVAVREKAIENLKAHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIESIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKEKLIGNIQDGISKGKKHAIIALTELMMDANELAKEIEAGTG
RETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRNDLFKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttgacaagtggtggtgacgcccctggtatgaacgcagca
atccgtggtgtggtacgtactgcactgggtgctggtcttgaagtttatggtatctatgat
ggctacctaggcttgtacgaaggccgtattaaacaacttgatcgttcaagcgtttctgat
gtgattaaccgtggtggtacgttcttgggatcagctcgtttcccagaatttaaagaagtt
gcggtacgtgaaaaagcgattgaaaacctaaaagcacacggtattgatgcgcttgtggtt
atcggcggcgacggttcgtacatgggtgcgaagaaactgactgaaatgggttacccatgt
atcggtctaccaggcacgattgacaacgatatcgcaggtacggattacaccatcggttac
ctaacggcgctgaacacggttatcgaatcgatcgaccgtctacgcgatacttcatcttct
caccagcgtatttctatcgtagaaatcatgggtcgtcactgtggtgacctcactctgatg
tctgctatcgcaggtggctgtgaatacatcatcacaccagaaactggcctagataaagag
aagctgattggcaacatccaagacggcatttctaaaggtaagaaacatgcgatcatcgcg
ctgactgagctgatgatggacgcgaacgaactggcaaaagagatcgaagcgggaacgggt
cgtgaaactcgtgccacggttcttggtcacatccaacgtggtggccgtccaactgcgttc
gaccgtgttcttgcgtctcgtatgggtaactacgcggttcacctattgatggaaggtcat
ggtggccgttgtgttggtatcgtgaaagagcaacttgttcaccacgacatcatcgatgca
atcgagaacatgaagcgtccagttcgcaatgatctgttcaaagtagcagaagagctattc
taa

DBGET integrated database retrieval system