KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00392Help
Entry
VVMO6_00392       CDS       T01415                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VVMO6_00392
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VVMO6_00392
Enzymes [BR:vvm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VVMO6_00392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(443900..444829)
Genome map
AA seq 309 aa AA seqDB search
MTNSLYKKHIISIPELSRAELELIVKTAGQLKAEPNPELIKNKVVASCFFEPSTRTRLSF
ETAIQRIGGDVIGFDDGGNTSLAKKGETLSDSVQVISNYVDAFVMRHPQEGAARLASEFS
NGVPVINAGDGANQHPTQTLLDLFTISETQDRLDNLNVAFVGDLKYGRTVHSLTQALAKF
NNIRFFFVAPDALAMPDYILEDLDEAGISYSLHTDMETVIPELDILYMTRVQKERFDESE
YAHIKSAYILTAALLEGARENLKVLHPLPRVDEITTDVDKTPHAYYFQQAGNGVYAREAL
LALVLNESL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactcgctttataagaagcacattatctccattccagagcttagccgcgctgag
ctggaattgattgtcaaaacggcaggtcagttaaaagcagagccaaacccagagctgata
aagaacaaggtcgtcgcgagttgtttcttcgagccttccacccgtactcgcctgtcgttt
gaaacggccatccaacgcatcggtggcgatgtcattgggtttgacgatggtggtaacacc
tcactggcgaaaaaaggcgaaacgctgtctgactctgtacaagtcatctcgaactatgtg
gatgcttttgtcatgcgtcacccacaagaaggcgctgcgcgtctggcttctgaattttct
aacggtgttccggtgatcaacgccggtgatggtgctaaccagcatccaactcaaacgctg
cttgatctgttcactatctccgaaacgcaagatcgtttggacaacttgaatgtggcgttt
gtcggtgacttaaaatacggccgcaccgtacactcgttgacgcaagccttggcaaaattc
aacaacatccgcttcttctttgttgcgccagacgcattggcgatgccagattacattctt
gaagatctggatgaagctggcattagctacagtctgcacacagacatggaaaccgtgatc
cctgagctggatattctctacatgacgcgcgtacaaaaagaacgtttcgatgaatcggaa
tacgcgcacattaaatccgcctacatcctcaccgcagcgctattggaaggcgcacgtgag
aacctcaaagtgctgcatccactgccacgtgtggatgagatcaccactgacgtcgacaaa
acaccgcacgcttactacttccagcaagcaggcaatggcgtttacgctcgtgaagccttg
ttggcactggtactgaacgaatcactgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system