KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00495Help
Entry
VVMO6_00495       CDS       T01415                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vvm  Vibrio vulnificus MO6-24/O
Brite
Enzymes [BR:vvm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VVMO6_00495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:550099..550725
Genome map
AA seq 208 aa AA seqDB search
MSNPQAERLVHFLAVNGIRDSEVLSAIARVPRECFLSQAMMHQAYDNNALPIGQGQTISQ
PYIVAKMTELLRLKRDSKVLEIGTGSGYQTAVLALLVEHVYSVERIKSLQWDAKRRLKQL
DIYNVSTKHGDGWLGWENKGPFDAIIVTAAAESVPPVLLQQLNDGGRMVLPVGTDEQQLI
LIERQKDQFVSQVIEAVNFVPLIAGDLA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcctcaagcagaaagattggttcatttcttagcggtcaatggcatccgtgat
agcgaagtgctatctgccatcgctcgtgtaccgagagagtgttttttgtcacaagctatg
atgcatcaggcttatgacaacaacgcattgcctattggtcaaggtcagacgatctctcag
ccctatattgtggccaaaatgacggaacttttgcgtctcaaaagagacagtaaagtattg
gaaattggcactggatcgggttatcaaaccgcagtattagcgcttctggttgagcatgta
tattctgttgagcgaatcaaatctttacagtgggatgcaaaacgtcgcttaaaacagttg
gatatttacaatgtctcgacgaagcatggcgacggctggcttggttgggaaaataaagga
ccttttgacgcgatcattgtgaccgccgcagcggaaagtgttccaccagtgttacttcaa
caattgaatgatggtggccgcatggtactccctgttggtacggatgagcagcagttgatc
ttgattgagcgtcaaaaagatcagtttgtttcccaagtgattgaagcggtgaactttgtg
ccgctgatcgccggagacttggcataa

DBGET integrated database retrieval system