KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00533Help
Entry
VVMO6_00533       CDS       T01415                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVMO6_00533
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VVMO6_00533
   00020 Citrate cycle (TCA cycle)
    VVMO6_00533
   00620 Pyruvate metabolism
    VVMO6_00533
Enzymes [BR:vvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VVMO6_00533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:592616..594508
Genome map
AA seq 630 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVSVGDKVEEEQSLITVEGDKASMEVPASQAGIVKEIKVV
AGDKVTTGSLIMVFEAEAAGAPGAAAAAPVPAVAPVAAPAAASELKEVCVPDIGGDEVEV
TEILVAVGDSIAEEQSLLTVEGDKASMEVPAPFAGTLKEIKVAAGDKVSTGSLVMVFEVA
GSGAAAPAPVAAAAPAAAPAAVSGVKEVNVPDIGGDEVEVTEIMVAVGDTVSEEQSLITV
EGDKASMEVPAPFAGTVKEIKVAAGDKVSTGSLIMVFEVAGAAPVAAAAPAQAAAPAPAV
APVAKAEAQATTSDFKENDEYAHASPVVRRLAREFGVNLSKVKGSGRKSRILKEDVQAYV
KDALKRLESGAVAAASGKGDGAALGLLPWPKVDFSKFGETEVQPLSRIKKISGANLHRNW
VMIPHVTQWDNADITELENFRKEQNAIEAKKDSGMKITPLVFIMKAAAKALEAFPAFNSS
LSDDGESLILKKYVNIGIAVDTPNGLVVPVFKDVNKKGIYELSEELMVVSKKARAGKLTA
ADMQGGCFTISSLGGIGGTAFTPIVNAPEVGILGVSKSEIKPVWNGKEFAPRLQLPLSLS
YDHRVIDGAEGARFITYLNECLSDIRRLVL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaaattaatgtacctgatatcggtgcggatgaggttgaagttactgagatt
cttgtaagcgttggcgacaaggttgaagaagagcagtctctcattactgtagaaggcgac
aaggcttctatggaagtacccgcctctcaagcgggtattgtaaaagaaatcaaagttgtt
gctggcgataaagtaacaacaggttctctcatcatggtctttgaagctgaagcggccggc
gctccgggtgcagcagcggctgcaccagttcctgctgtagcaccagtcgctgcacctgca
gcagcaagtgaactgaaagaagtttgtgtaccggatatcggtggcgacgaagttgaagtg
actgaaatcctagttgctgttggcgattcaatcgctgaagagcaatctctactgacagta
gaaggtgacaaagcttcaatggaagtaccagcaccattcgcaggtactctaaaagaaatc
aaagtggcagcaggcgataaagtgtctactggctcactcgtgatggtatttgaagtggcg
ggttcgggcgcagcagcacctgcaccagttgcagcagcagctccggcggcggctccagca
gcagtctctggagtaaaagaagttaacgttcctgatatcggcggcgacgaagttgaagtc
actgaaatcatggttgccgttggcgatacagtctctgaagagcaatctctgattactgta
gaaggcgacaaagcatctatggaagtacctgcacctttcgctggtacggttaaagaaatc
aaagttgcagctggtgacaaagtttctactggttctctaatcatggtgttcgaagttgct
ggcgcagcgccagttgcagcagcggcacccgctcaagcagcagctccagctcctgcggta
gctccagtagcaaaagcggaagctcaagcaacaactagtgatttcaaagaaaacgacgag
tatgctcacgcatctccagtggttcgtcgtctagctcgcgagttcggcgtaaatctttct
aaagtgaaaggttctggtcgtaagagccgtatcctgaaagaagacgttcaagcttacgtg
aaagatgcacttaagcgtcttgagtctggtgcagttgcagcggcttctggtaaaggcgat
ggcgcagcgcttggcctactaccatggccgaaagtggacttcagcaagttcggtgaaaca
gaagttcagccactatctcgcattaagaagatctcgggtgcaaacctacatcgtaactgg
gtaatgatccctcacgttacacagtgggataacgcggatatcactgagctagaaaacttc
cgtaaagagcaaaacgcgattgaagcgaagaaagactcgggcatgaagatcacgccactt
gtgttcatcatgaaagcggcagcgaaagcactagaagcattcccagcgttcaactcttcg
ctatcagacgacggtgaaagcttgattctgaagaaatacgtgaacatcggtattgcggtg
gatacgccaaatggcctagtggttcctgtctttaaagacgtgaacaagaaaggcatctac
gagctatctgaagaactgatggtggtttctaagaaagcacgtgctggtaagctgactgca
gcggacatgcaaggtggctgtttcacgatttcaagcctaggtggtatcggtggtactgcg
tttacaccaatcgtaaacgcgccagaagtgggtatccttggtgtgtctaagtctgaaatt
aagccagtttggaatggtaaagagttcgctcctcgcctacaactgcctctatctctatca
tatgatcaccgtgtgattgatggtgcagaaggtgcgcgcttcattacttacctaaacgag
tgcctatctgacattcgtcgtttggttctgtaa

DBGET integrated database retrieval system