KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00614Help
Entry
VVMO6_00614       CDS       T01415                                 

Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VVMO6_00614
   00240 Pyrimidine metabolism
    VVMO6_00614
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    VVMO6_00614
   03430 Mismatch repair
    VVMO6_00614
   03440 Homologous recombination
    VVMO6_00614
Enzymes [BR:vvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     VVMO6_00614
DNA replication proteins [BR:vvm03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     VVMO6_00614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:694351..694752
Genome map
AA seq 133 aa AA seqDB search
MTENEKLYLQEMGISLWQLHHPERMMGYEMPTFSLPEECQLLLIAPSCPISQTALFFEKV
LKSMQLELSQARHITPEQLSALEPHSLQWVWFAGCPVQPLPIVAKVLQSPELAQIDGHNE
HRRALWQQIRSYE
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacgaaaagttgtatttacaggaaatgggtatttcgctttggcaattgcat
catccagaacggatgatgggctatgaaatgccaaccttctccctgcctgaagagtgccag
ttactgttgatcgcaccgagttgccccatttcgcaaacggcactattttttgaaaaagtg
ctcaaaagcatgcaattggaattgtctcaagcaaggcatattaccccagagcaattaagc
gcgctcgaaccacattctttgcaatgggtttggtttgcgggctgtcctgttcaacctctt
cctatagtagccaaagtgctccaatcgccagagttggctcaaattgatggtcataatgag
catcgtcgtgcgctgtggcaacagatccgttcgtatgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system