KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00614Help
Entry
VVMO6_00614       CDS       T01415                                 

Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:vvm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vvm00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:vvm03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:vvm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:vvm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:694351..694752
Genome map
AA seq 133 aa AA seqDB search
MTENEKLYLQEMGISLWQLHHPERMMGYEMPTFSLPEECQLLLIAPSCPISQTALFFEKV
LKSMQLELSQARHITPEQLSALEPHSLQWVWFAGCPVQPLPIVAKVLQSPELAQIDGHNE
HRRALWQQIRSYE
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacgaaaagttgtatttacaggaaatgggtatttcgctttggcaattgcat
catccagaacggatgatgggctatgaaatgccaaccttctccctgcctgaagagtgccag
ttactgttgatcgcaccgagttgccccatttcgcaaacggcactattttttgaaaaagtg
ctcaaaagcatgcaattggaattgtctcaagcaaggcatattaccccagagcaattaagc
gcgctcgaaccacattctttgcaatgggtttggtttgcgggctgtcctgttcaacctctt
cctatagtagccaaagtgctccaatcgccagagttggctcaaattgatggtcataatgag
catcgtcgtgcgctgtggcaacagatccgttcgtatgagtaa

DBGET integrated database retrieval system