KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00660Help
Entry
VVMO6_00660       CDS       T01415                                 

Definition
beta-D-galactosidase subunit alpha
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VVMO6_00660
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VVMO6_00660
Enzymes [BR:vvm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VVMO6_00660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(746601..749699)
Genome map
AA seq 1032 aa AA seqDB search
MNNWENFLHLHENRMAPRAYFFSYDTVQQAQTFQRELSSRFVLLSGQWQFHYFSNPMLVP
DEFYSQTMSDWGHITVPNMWQMEGHGDLQYTDEGFPFPIDVPFVPTDNPTGAYQRTFTLG
PQWDDKQTIIKFDGVETYFEVYVNGHYVGFSKGSRLTAEFDISSYAQLGENLLSVRVMQW
ADSTYIEDQDMWWTAGIFRDVYLIGKEPVHVQDLTVRTDFADDYQSATLSAQVELENLST
AIASGYTLEYALHDKGTVVASGQCDSLTIQNRHSASFAIDMVNPTHWTAENPYLYHLFIT
LKDHQGKVVEVIPQRVGFRDIKVRDGLFYINNQYVMLHGVNRHDNDHLKGRAVGMDRVEK
DLMLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVETHGFANVGDLSRITNDPA
WEAVFVDRAVRHVHAQKNHPSIIMWSLGNESGYGCNIRAMYAATKALDDTRLVHYEEDRD
AEVVDVISTMYSRAQLMNYFGEHPHEKPRIICEYAHAMGNGPGGLTEYQNVFYAHDHIQG
HYVWEWCDHGILARDEHGQEFYKYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLKEYKQVI
APVKIRAVEGCHDRFIVENKLWFTNLDDYTITAEIRAEGDTLRSVPFKVEALAANSAREV
SIDLPELDEREAFINFTVRKDSRTLYSEANHDIAVYQFQLKENTATLPALVNHNVQPLAL
EESRLEHVITGHNFTLTFSKVNGKLTSWRVNGEELIQSEPRLNFFKPMIDNHKQEYEGLW
HPAHLQIMQEHFRTLSVDASDDAILITTTSIVAPPVFDFGMRCTYRYQINAQGHLNVELS
GERYGDYPHVIPVIGLDLGINGRFDQVSYYGRGPEENYQDSRQANVIDVYHTNVADMFEN
YPFPQNNGNRQHVRWASLTNRHGTGLLVKPQQEINFSAWFYTNQNLHQAQHTIELEKSGY
ITLNLDHQVMGLGSNSWGSEVLDSYRVYMDAFRYGLTLMPLQAGDCSAQVMANHDFDNAF
FTSTDSKIVNEA
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaactgggaaaacttcctccatttacatgagaacagaatggcgccgcgtgcgtac
ttcttctcctatgataccgttcaacaagctcaaacctttcagcgtgagttgagcagccgc
tttgtgctgctaagtggtcagtggcaatttcattacttcagcaacccaatgctggtgcct
gatgagttttactcacaaaccatgagcgattgggggcacattaccgtacctaacatgtgg
caaatggaaggccacggcgatcttcaatacaccgacgaaggtttcccattcccaattgat
gtgccttttgtacccaccgacaacccaacgggtgcttatcagcgcactttcactttgggt
cctcaatgggacgacaaacaaaccatcatcaagttcgatggcgtggaaacctacttcgag
gtgtacgtcaacggccactatgtcggttttagtaaaggcagccgtcttactgcagagttc
gacatttcttcctacgcacaactaggtgaaaacttactctctgtgcgcgtgatgcaatgg
gccgattcgacttacattgaagaccaagacatgtggtggacggcggggatcttccgtgat
gtttaccttataggcaaagagccggttcacgtccaagatctgactgttcgtactgatttc
gccgacgattaccaaagtgcgacgctcagcgctcaggtcgaattggaaaatctttctacc
gctatcgcgtctggctacacgctggaatacgcgctgcatgacaaaggcactgtcgtagcc
agcggtcaatgcgattcactgactatccaaaaccgccattcagccagcttcgccattgat
atggtgaacccaacgcattggacagcagaaaacccttacctttaccacttgttcatcacc
ttaaaagatcaccaaggaaaggtcgtggaagtgatcccacaacgcgtgggtttccgtgat
atcaaagtgcgtgacggcctgttctacatcaacaaccaatacgtgatgctgcatggggtc
aaccgtcatgacaacgaccacctaaaaggtcgtgcagtaggcatggaccgcgtggaaaaa
gatctgatgttgatgaagcagcacaacatcaactcagttcgcaccgcgcactacccgaac
gacccacgcttctacgagctgtgtgatatttacggcctgtttgtgatggcagaaaccgat
gtggaaacccacggctttgccaacgttggcgacctcagccgcatcaccaacgatccagca
tgggaagcggtgtttgttgatcgcgctgtgcgccatgtacacgcacagaaaaaccaccca
tcgatcatcatgtggtcactcggtaacgaatcgggttatggctgtaacatccgcgccatg
tacgccgcaaccaaagcccttgatgacacccgtttggtgcactacgaagaagaccgcgat
gctgaagtagtggacgtgatttccactatgtactcgcgtgcacaactgatgaactacttt
ggcgaacacccacacgagaagccacgcattatctgcgaatacgcccacgcgatgggtaac
gggccgggtggtctcactgaataccaaaacgtgttctacgcgcatgaccacattcaaggc
cactacgtgtgggaatggtgtgatcacggcattctagcgcgtgatgaacacggtcaagag
ttctacaaatacggcggcgattacggcgattacccaaacaactacaacttctgtatggat
gggctgatttacccagatcaaaccccgggccctggcctgaaagaatacaagcaagtgatt
gcgccagtgaaaatccgcgccgttgaggggtgccatgaccgcttcatcgttgaaaacaaa
ctgtggttcaccaaccttgatgactacaccatcaccgctgaaattcgcgccgaaggcgac
accttgcgtagcgtgccgtttaaagtcgaagcactggctgcaaacagcgctcgtgaagtg
agcattgacttgccagaattggatgagcgcgaagccttcattaacttcaccgtacgtaaa
gacagccgcaccttgtatagcgaggccaaccacgacattgcggtgtaccagttccaactg
aaagaaaacaccgccacgttgcctgcgttggtcaaccacaatgttcaaccattggcgctt
gaagaaagccgcctagagcacgtgatcacaggtcataacttcacgctcactttctcgaaa
gtaaacggcaaactgacctcatggcgtgtgaatggtgaagagttgattcaatcagagcca
agattgaacttcttcaaaccaatgattgataaccacaaacaagagtacgaagggttgtgg
caccctgcgcatctgcaaatcatgcaagagcacttccgtacgctgagcgtggatgcgagc
gacgatgccattctgatcaccaccaccagcattgtggcaccacccgtgtttgattttggc
atgcgttgtacttatcgctaccaaatcaacgcgcaagggcatttgaacgtagaactgagc
ggcgaacgttacggcgactaccctcacgtgattccggtgattggtttggatttgggcatc
aacggtcgctttgaccaagtgagctactacggtcgcggccctgaagagaactatcaagac
agccgccaagctaacgtaattgatgtttaccacaccaacgtggcggacatgttcgagaac
tacccgttcccgcaaaacaacggcaaccgccagcacgtgcgttgggcatcgctcaccaac
cgtcatggcacagggttattggtgaaacctcagcaagagatcaacttcagtgcgtggttc
tacaccaaccaaaacctgcatcaagcacaacatacgattgagctagaaaagagtggctac
atcacccttaaccttgaccatcaagtgatgggcttgggttcaaactcttggggcagtgaa
gtgctcgactcttaccgcgtgtatatggatgcgttccgctatggcctcactctgatgcca
ttgcaagcaggcgattgcagcgcgcaagtcatggcaaaccatgatttcgacaacgcattt
ttcacttcaaccgatagcaaaatcgttaacgaggcgtaa

DBGET integrated database retrieval system