KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00678Help
Entry
VVMO6_00678       CDS       T01415                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    VVMO6_00678
Enzymes [BR:vvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     VVMO6_00678
Exosome [BR:vvm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VVMO6_00678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(768353..769870)
Genome map
AA seq 505 aa AA seqDB search
MTEQKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPQAGWVEHDPMEIYATQSST
LVEALGKKGIRSDQVAAIGITNQRETTIVWNKETGKPVYNAIVWQCRRTADICEDLKARG
LESYIRENTGLVLDPYFSGTKVKWILDNVEGAREDAEAGKLLFGTVDTWLVWKMTQGRVH
VTDYTNASRTMLFNINDLCWDSKLLEEMGIPASMMPEVKRSSEIYGQTNIGGKGGTRIPI
SGIAGDQQAALYGQMCVEAGQAKNTYGTGCFLLMNTGQEKVTSRNGLLTTLACGPKGEPA
YALEGAVFMGGASIQWLRDELKLISDAHDSEYFATKVDTSNGVYVVPAFTGLGAPYWDAY
ARGTIVGLTRGVNSNHIIRATLEGIAYQTRDVLDAMQADSGIKLSALRVDGGAVANNFLM
QFQSDVLDTEVHRPKVTEVTALGAAYLAGLAVGYWNSIDELQGKAEIDRSFLPHQDEEKR
SRRYKGWKRAVKCAQTWSELRDLED
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcagaagtacatcgttgcactggaccaaggcaccaccagctctcgtgctgtg
gttttagatcatgacgcgaacatcgtttctgtctcccagcgcgaattcactcagatttac
ccacaagcaggctgggtagaacatgatccaatggaaatttacgccactcagagctctaca
ctcgttgaagcactgggtaaaaaaggcatccgcagtgaccaagtggctgccatcggtatc
accaaccaacgtgaaaccaccatcgtttggaacaaagaaacaggcaaacctgtttacaac
gccattgtttggcagtgccgtcgtactgccgacatctgtgaggacctaaaagcgcgcgga
ttggaatcttacattcgggaaaacaccggccttgtacttgacccttacttctcgggcacc
aaagtaaaatggattctcgataatgttgaaggggcacgtgaagacgccgaagcgggtaaa
ctgctgtttggtaccgttgatacttggctggtctggaagatgacccaaggccgcgtgcac
gtcactgactacaccaatgcctcccgcaccatgctgttcaacatcaatgacctatgttgg
gatagcaaactgctcgaagaaatgggcatcccagcgtcgatgatgccggaagtaaaacgc
tcatcggaaatttacggccaaaccaacattggtggtaaaggcggtacgcgtattcctatc
tcaggcattgcgggtgaccaacaagcggcgctgtacggccaaatgtgtgtcgaagctggc
caagcgaaaaatacctacggaacgggttgtttcttgttgatgaacaccggacaagagaaa
gtgacctcacgcaacggtttgttgaccacactcgcgtgtggaccaaaaggcgagccagcc
tacgcactggaaggtgcggtctttatgggcggcgcttcgattcagtggctgcgtgatgag
ctgaaactgatttccgatgcgcacgattccgaatacttcgccacaaaagtggacacctca
aacggcgtgtatgtggtgccagcctttacgggcttaggcgctccgtactgggatgcctat
gctcgcggtaccattgttggtctcactcgtggcgttaactctaaccacattatccgtgca
acgttagaaggcattgcctaccaaacccgtgatgtactggacgccatgcaagcagactct
ggtattaagctctcagccctacgcgttgatggcggcgctgtcgccaacaacttccttatg
cagttccaatctgatgtgcttgataccgaagtgcatcgtccaaaagtcaccgaagtgacc
gcactgggcgctgcgtacctagcaggcttggccgtggggtactggaacagcattgatgaa
cttcaaggcaaagcagagatcgaccgcagcttccttcctcatcaagatgaagagaaacgc
agccgacgctataaaggctggaaacgcgcagtcaaatgtgcgcaaacttggtctgaattg
cgcgatctcgaagattaa

DBGET integrated database retrieval system