KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00688Help
Entry
VVMO6_00688       CDS       T01415                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VVMO6_00688
Enzymes [BR:vvm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     VVMO6_00688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:784545..786659
Genome map
AA seq 704 aa AA seqDB search
MMLNGSLQATLSMLEQQAQQGYLRLLDYQFARFIGEQSQHSGLALLAAAVSAELGKGHIC
LPLFDELGQVCELASKIGLFGEAATELNAQLQSFDWRALLQTSRLVGTQGEAVPLMFDGE
RVYLHRYWHYEVVLAQKLNQLSHGIELNASSAASLSALLDRLFARDYRFLFETLIAAQAS
GSTQVQRQQWVCDFLDVVEEHRLDWTAIEQVLSQVSKVSDLNALDHLVPHAACINWQKVA
AAVALTRRFAVISGGPGTGKTTTVTKLLAALIEQAGAQTPTIRLVAPTGKAAARLTESIG
KAVQSLAVEPSLKALIPTEASTLHRLLGAIPGSAEFRHHSQNPLHLDVLVVDEASMVDLS
MMYKVIDALPKHARLILLGDKDQLASVEAGAVLGDICAFSASGYSAEQAATLAKLTGYQA
LPKSASRLAPVADSLCMLQKSYRFDARSGIGQLAKAINAGSVAALESVWQREFNDIEHHP
LDASHYNHMLQTLVSEYSHYLARIALTQQHLEPKERESSAVRAKAGLNLFHRCRLLCAVR
EGNFGVAGLNLRIERALAARNLIKVKDEIWYHGRPVMVTRNDYALGLYNGDIGICMWDDT
DEAPRLKVYFELADGSVKAVLPSRVPEHETAYAMTIHKSQGSEFDFTLMILPADFSPILT
RELIYTGITRAKKRLALYADLQVLKRGMKIKTQRASGLPHRLGQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgaatgggtcactccaagcgacgctgtcgatgctggaacagcaagcccaacaa
ggctacctgcgcttattggattatcaatttgcgcgctttattggtgagcagagtcagcac
agcggattggcgctgttggccgctgcggtcagtgccgagttaggcaaagggcatatttgc
ttgcctctgtttgatgaacttggccaagtctgtgaattggccagcaaaattggcctgttt
ggtgaggcggcaaccgagctgaacgcccagttgcagtcgttcgactggcgagcattgctg
caaaccagtcgcttggttggcacccaaggggaagcggtgcccttgatgttcgatggggaa
cgagtttatctgcatcgctattggcactatgaagtcgttttggcgcaaaaacttaatcaa
ttgagtcacggtattgaacttaacgccagctcagcggcatcgttatccgcattgctggat
cgattgttcgcgcgagattaccgctttttgttcgaaacgctgattgccgcgcaagcgagc
ggcagtacccaggtgcagcgacagcaatgggtgtgtgattttctcgacgtggttgaagag
caccgtttggattggacggcgattgaacaagtgctgagccaagtaagcaaagtctcagat
ctcaacgcgctggatcatcttgtgcctcatgcggcctgcattaattggcaaaaggtagct
gccgcggtggcgttgacgcgtcgttttgccgtgatctctggggggccgggaacaggcaaa
accaccaccgtcacgaaattgttggcggcgctgattgagcaagctggagcgcaaacgccc
accattcgtttggtggcgccaacgggtaaagcggcggcgcgtttgaccgaatccatcggt
aaagcggtgcaatctttagccgtagagccgagtttaaaggcgttaatccccacagaagcc
tcaacattacatcgcttgttaggcgcgatccccggcagtgccgagtttcgtcatcacagt
caaaacccgctgcatttggatgtgctggtggtggatgaagcctcaatggtcgatctttcg
atgatgtataaagtgattgacgcgctgcctaaacatgctcgtttgattttactcggtgat
aaagatcagttggcctccgttgaagcgggggcggtgctgggggatatctgcgcattttct
gcttccggatacagcgcagagcaagcagcaacgctcgcgaagttaacgggttatcaagcg
ctgccaaagagtgccagccgtttggcaccagttgcagatagcttgtgtatgttgcaaaag
agctatcgttttgatgctcgctcaggaattggccaattggcaaaagcgatcaatgccggt
tccgtggcggcgttagagagtgtatggcagcgagagtttaacgatatcgaacatcaccca
ttggatgccagccactacaaccatatgttgcaaacgcttgtaagtgagtactcacattat
cttgctcgcattgccttaactcagcagcatcttgagccgaaagagagagaaagcagtgct
gttcgagccaaagcgggactgaatttgtttcatcgttgccggttactttgcgccgtgcgt
gaaggcaattttggtgtggccggacttaaccttcgcattgaaagagccttagctgcgcgg
aatttgattaaagtgaaggacgagatttggtatcacggcaggcctgtaatggtgacgcgt
aatgattacgcgcttgggctttacaacggcgacattggcatctgcatgtgggatgacact
gacgaagccccgcgtctaaaagtctattttgagttggctgacggcagcgttaaagcggta
ttaccaagccgagtgccagaacatgaaacagcctatgcgatgacaatacataaatcacaa
ggcagcgaatttgattttaccttgatgattttgcctgccgatttcagcccaatactgacg
cgagagctgatctacacgggcattactcgagcgaaaaagcgtttagcgctgtatgccgat
ctccaagtcctgaaacgtggtatgaagataaaaacacagcgagcgagcggcctgccacac
cgtttgggccagtaa

DBGET integrated database retrieval system