KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00800Help
Entry
VVMO6_00800       CDS       T01415                                 

Definition
N-succinyl-L,L-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VVMO6_00800
  Amino acid metabolism
   00300 Lysine biosynthesis
    VVMO6_00800
Enzymes [BR:vvm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     VVMO6_00800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(894520..895653)
Genome map
AA seq 377 aa AA seqDB search
MTDSPVLALTKDLISRQSVTPEDAGCQDVMIARLEALGFTIERMVFEDTTNFWARRGTQA
PLFAFAGHTDVVPAGKLEHWHTPPFEPTEKEGYLYGRGAADMKGSLAAMIVATERFIAEH
PDHQGSIGFLITSDEEGPFINGTVRVVETLMARDENIDMCIVGEPSSTEVVGDVVKNGRR
GSITGDLTVKGTQGHVAYPHLADNPVHKSLLAIHALATTEWDKGNEYFPPTSFQIPNVQA
GTGASNVIPGEFHVQFNLRFSTELCNERIVERVTQTLDQHDLNYDLKWTYNGDPFLTDTG
ALLDAVVDAVDSVNQTKPALLTTGGTSDGRFIARMGGQVVELGPVNATIHKVNECVKIDD
LEKLTDMYQKTLENLLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacagacagcccagtactggctctaaccaaagatctcatcagtcgccagtcggtaacc
cccgaagacgccggttgccaagatgtcatgatagcgcgcctagaggctcttggttttacc
attgagcgcatggtgtttgaagataccaccaacttttgggctcgccgtggcacacaagcg
ccactcttcgcctttgcaggccacactgacgtggtgcccgctggaaaattagagcattgg
cacacaccgccttttgaaccgaccgaaaaagaaggctatttgtatggccgtggggctgcg
gatatgaaaggctcattggcagcaatgatcgtcgcgacggagcgttttatcgcagaacat
cccgatcatcagggttctatcggtttcctgatcacctcagatgaggaaggcccgtttatc
aatggcacggttcgtgttgtggaaacgttgatggcgcgcgatgaaaacatcgacatgtgt
attgtcggcgagccatcaagcaccgaagtcgttggtgatgtggtaaaaaatggtcgtcgt
ggttcgatcactggcgacttgaccgtcaaagggactcaaggccatgtggcttaccctcat
cttgcggacaacccagtgcacaaatcgcttttggcaatccacgccctagcgaccactgag
tgggacaagggtaatgaatacttcccgccaaccagcttccagatcccgaacgtacaagcg
ggtacgggtgcgtccaatgttatcccaggtgagttccacgttcagttcaatttgcgcttt
agtaccgagctttgcaacgagcgaattgtggaacgagtgactcaaacactcgaccaacat
gacctcaattacgatctcaaatggacatacaacggcgacccattcctaactgatacggga
gcacttctggacgcggtggtggatgctgtcgatagcgtcaaccaaaccaaacccgcgtta
ctgaccactggcggtacttcagacggacgctttatcgcacgaatgggtgggcaagtggtt
gagctcggaccggtgaacgccaccatccataaagtgaacgagtgcgtgaagatcgatgac
ttagaaaagctcaccgatatgtaccagaaaacattggaaaacttattggcatga

DBGET integrated database retrieval system