KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00859Help
Entry
VVMO6_00859       CDS       T01415                                 

Definition
enoyl-CoA hydratase/delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase/3-hydroxyacyl-CoA dehydrogenase/3-hydroxybutyryl-CoA epimerase (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVMO6_00859
   01212 Fatty acid metabolism
    VVMO6_00859
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VVMO6_00859
   00650 Butanoate metabolism
    VVMO6_00859
  Lipid metabolism
   00071 Fatty acid degradation
    VVMO6_00859
   01040 Biosynthesis of unsaturated fatty acids
    VVMO6_00859
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VVMO6_00859
   00310 Lysine degradation
    VVMO6_00859
   00380 Tryptophan metabolism
    VVMO6_00859
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VVMO6_00859
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VVMO6_00859
   00281 Geraniol degradation
    VVMO6_00859
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    VVMO6_00859
Enzymes [BR:vvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VVMO6_00859
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VVMO6_00859
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VVMO6_00859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:952009..954126
Genome map
AA seq 705 aa AA seqDB search
MSEQKAFNLKIDEQNIAWLGIDVPNEKMNTLQAAFADEMKAIFAQLKDSSGLKGLIVHSL
KPDNFVAGADVRMLEACKTAPEAEALARQGQELFQQLSDLPYPVVAAIHGPCLGGGLELA
LACDFRVCSDDDATRLGLPEVQLGLLPGSGGTQRLPRLIGLLPSLDLILTGKQLRAKKAK
KLGVVDACVPQTILLDVAKQFVEKGKKRAKQKVTTKEKLLSGSGLGRKFVFEQAAKKTHE
KTRGNYPATVAILQVIQHGLEKGMKQGLELEAKRFGELVMSNESKALRSIFFATTEMKKE
TGSEAKPSKVGMVGVLGGGLMGAGISHVSVAKAKVPVRIKDVSNDGVLNALKYNYKLFDK
QRKRRILSKAQLQSKMLQLSGGTDFTSFNRTDVVIEAVFEDLSLKQQMVADIEANAKPET
IFATNTSSLPIHKIAEKAQRPENIVGLHYFSPVEKMPLVEVIPHESTSEETIATVVALAK
KQGKTPIVVKDQAGFYVNRILAPYMNESAHILLANEPIDKIDTALLDFGFPVGPITLLDE
VGVDIGAKIMPILVAELGARFKGPDVFDVLLNDGRKGRKSGKGFYTYKGKKKEVDKSVYK
LLKLTPESKLSDNDIALRCVLPMLNEAVRCLDDGIIRSPRDGDIGAIFGIGFPPFLGGPF
RYMDQFGLKELVEKMNQFAEKYGDRFAPCDGLLTRAGEGRRFYDN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcaaaaagcgtttaatctaaagattgatgagcagaacattgcatggcttggc
attgatgttccaaacgaaaaaatgaatacccttcaagcggcttttgccgatgaaatgaag
gcgatttttgctcaactgaaagatagcagtggcctaaaagggctgatcgtgcattcgttg
aaacctgacaactttgttgcaggcgcggatgttcgaatgctagaagcgtgcaaaacggcg
ccagaagcagaagcccttgcacgccaaggacaagagttatttcaacaactttctgatttg
ccttatccagtggtggctgcaatccacggcccgtgtctgggtggcggtttggaattggcg
ttagcgtgtgatttccgtgtgtgtagtgacgacgatgccactcgtcttggtttaccagaa
gtccagcttggtctattaccgggctctggtggcactcagcgtctccctcgcttgattggt
cttcttccttcattggatctgatcctgacgggtaaacagcttcgagccaagaaagccaag
aaattgggcgttgtcgatgcctgtgtgccacaaactattttgttggatgtggcaaagcag
tttgttgaaaaaggcaagaagcgcgcaaaacaaaaagtgacgacaaaagagaaattgctc
tctgggagtgggttagggcgtaagtttgtgtttgaacaagcggcgaaaaaaacgcacgaa
aaaacacgtggtaactacccagcgactgtcgccattttgcaagtcatccagcatggcctt
gaaaaaggaatgaagcagggtttggagctggaagcgaagcgctttggtgagttggtcatg
agcaacgagtcgaaggctttacgttcgattttctttgccactacggaaatgaaaaaagaa
acgggcagtgaagcaaaaccaagtaaagtcggaatggtcggcgttcttggtggtggcttg
atgggcgcgggtatcagtcacgtcagtgtggcgaaagccaaagtgccagtacgcattaaa
gacgtcagcaatgacggcgtgctgaacgccttgaaatacaactacaagttgtttgataag
cagcgcaaacgtcgcattctctccaaggcgcaactgcagagcaaaatgctgcaattgagc
ggaggaaccgatttcaccagctttaatcgtaccgacgtggtaattgaagcggtctttgaa
gatctgtcgctcaagcaacaaatggtggcggacattgaagcaaatgcgaagccggagact
atcttcgcgacgaatacctcttctttgccaatccataaaattgccgagaaggcgcagcgg
cctgagaacattgtgggtttgcactactttagtccggtagagaaaatgcccttggtggaa
gtcattccgcatgaatcaacgtcggaagaaaccattgccacggtggtcgctttggcgaag
aaacaaggcaaaacgccgattgtggtgaaagatcaagcgggtttctatgtgaaccgaatt
cttgcgccgtacatgaatgaatctgcgcacattttgctagcaaatgagccgatcgataag
atcgataccgcattattggattttggcttccctgtcggtccaattacgttgctggatgaa
gtgggtgtagatattggtgcgaagatcatgcctatccttgtcgctgagttgggtgctcgc
tttaaagggccagatgtgtttgatgtgcttctcaatgatggccgcaaaggtcgcaagagt
ggaaaaggcttctacacctataaaggcaagaagaaagaagtggataagtccgtttacaaa
ctgctgaaactcaccccagagtcgaagctgagcgacaatgacattgcgcttcgttgtgtg
ctgccaatgctcaacgaagcggtacgctgtttggatgatggcattattcgttctcctcgt
gatggcgacattggggctatcttcggtatcggcttccctcctttcttaggtggcccgttc
cgttatatggaccaatttggtttgaaggaactggtagagaaaatgaaccaattcgctgag
aaatatggcgatcgctttgcgccgtgtgatggcttactcacgcgtgcgggagaaggacgt
cgtttctatgacaactag

DBGET integrated database retrieval system