KEGG   Vibrio vulnificus MO6-24/O: VVMO6_00888Help
Entry
VVMO6_00888       CDS       T01415                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    VVMO6_00888
DNA repair and recombination proteins [BR:vvm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      VVMO6_00888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:986894..987496
Genome map
AA seq 200 aa AA seqDB search
MRTSHMLEQLMEALRCLPGVGPKSAQRMAFHLLQRDRKGGLQLADALSHAMTEIGHCNEC
RTFTEEDVCHICNNPKRQENGLLCVVESPADIAAVEATGQFSGRYFVLMGHLSPLDGIGP
SDIGLDVLDYRLRRGDIKEVILATNPTVEGEATAHYIAELCREHKVDASRIAHGVPVGGE
LELVDGTTLSHSLLGRHKLN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccagccatatgctggaacaattgatggaggccttacgttgtttgcctggggtt
ggccccaagtcagcacagcgtatggcctttcatttgttacagcgagatagaaaaggcggc
ctgcagcttgcggatgcattaagtcatgccatgacggaaattggtcactgtaacgagtgc
cgtacttttaccgaagaagacgtttgtcatatctgcaacaacccaaaacgccaagaaaac
ggattattgtgtgtggtcgaaagccctgccgatatcgctgcggtggaagccacaggacaa
ttctctggtcgttactttgtgttgatggggcacctatcaccgcttgatggtattggacct
agtgatattggcctcgatgtccttgattatcgtctgcgtcgcggtgatatcaaagaagtg
atcttagcgaccaaccctaccgtggaaggtgaagcgaccgcgcactacatcgctgaactt
tgtcgagagcataaagtggacgccagtcgaattgctcatggtgttccggtcggcggcgaa
cttgagctggtggatggcacgacgctctcccattcgttactgggcagacacaaactcaac
taa

DBGET integrated database retrieval system