KEGG   Vibrio vulnificus MO6-24/O: VVMO6_01236Help
Entry
VVMO6_01236       CDS       T01415                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vvm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1381252..1382187)
Genome map
AA seq 311 aa AA seqDB search
MNDLFTKTDYSLYSNSMSFVRRPYVKDPVAADADLVVFGAPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNLFKKVKVIDGGDLVFDCGDAEDFTYRMEAATSAILKSGKTML
GLGGDHFITLPILRAYAKHYGEMALIHFDAHTDTYANGSSYDHGTMFYHAPKEGLISPKH
SVQVGIRTEYKQEGHGFNVINAMQANDMSVEEILADIRRIVADKPVYVTFDIDCLDPAFA
PGTGTPVCGGLNSDKILKIIRGLKDVNIVGMDVVEVSPPYDQSDLTALAGATIALELMYA
WAANKEFESEF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaactgattattcactctactcaaactcgatgagttttgtg
cgtcgtccgtatgtcaaagatcctgtcgcagcagacgctgacctggttgtttttggcgca
ccgctagacatggcaacctctggtcgtcctggcgcgcgtatgggcccagatgcgatccgt
cgtgcatcggtgaatcttgcatgggaaggtaagaaattcccttgggatttcaacctattc
aaaaaagtgaaagtgattgacggtggcgatcttgtcttcgattgtggtgatgcagaagac
ttcacttaccgtatggaagcagcgacctctgcgatcctaaaaagcggcaaaacaatgctt
ggccttggtggtgatcacttcatcacgctgcctattctgcgcgcttacgcaaaacactac
ggtgaaatggcactgatccacttcgatgcgcacaccgacacgtacgcaaacggcagcagc
tatgaccacggcaccatgttctaccatgcgccaaaagaagggcttatctctcctaagcat
tcagtacaagtcggtatccgtactgagtacaagcaagaaggtcacggctttaacgtcatc
aatgcgatgcaagccaacgacatgagcgtagaagagatccttgcagatattcgccgcatc
gtggcagataagcctgtgtatgtgacatttgatatcgactgtctcgatccggcttttgca
ccaggaactggtacacctgtctgcggtggcttgaactcggacaagattttgaaaatcatc
cgtggcctaaaagacgttaacatcgttggtatggatgtggtggaagtctctcctccatac
gatcaaagcgatttgactgcactggctggcgcaaccatcgcactggaacttatgtatgct
tgggcagcaaataaagagtttgaatcagagttctaa

DBGET integrated database retrieval system