KEGG   Vibrio vulnificus MO6-24/O: VVMO6_01254Help
Entry
VVMO6_01254       CDS       T01415                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VVMO6_01254
Enzymes [BR:vvm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     VVMO6_01254
    3.5.1.-  
     VVMO6_01254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1406225..1406869
Genome map
AA seq 214 aa AA seqDB search
MVDIFKNRTASLDVDPQQGFSELCPNELPVSGALEIVEALKQNHTKAKLKLVSRDMHPPG
AAWEAETPANMLEPVGLPEVDIKWNPHCIVGTQGVELLPGLPAIREYDFQMNKGIDPDAH
PYGAFYHDQADTLSTGGIEFLRAHRIDTVLVGGLALDFCVKKSIEQLVAADFKVILNLAS
TRAVFPENNPQVVSHLTALGVICIDDVNQLQLHE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggtagatatctttaaaaatcgcacagcgtcgttagacgtggatccgcaacaagggttt
agtgagttatgccccaatgaacttcctgtctccggtgcgttagagattgttgaagcgtta
aagcagaatcatacaaaagcaaagctgaagttagtgtcgcgcgatatgcatcctccggga
gctgcgtgggaagctgaaacgcctgcaaacatgttagagccggttggccttccggaagtg
gatattaaatggaatccacattgtattgtcggtacgcaaggtgtcgaattgcttccgggc
ttacccgctattcgagagtacgatttccaaatgaacaaaggtattgatcccgatgcccac
ccatacggggcgttttatcatgaccaagccgatacgctatcgacagggggaattgagttc
cttcgtgcccacagaatagatactgtgcttgtgggtggattggcgttggacttttgcgtg
aaaaaatccattgaacagcttgtcgccgcagactttaaggtgattctaaatttggcgtca
actcgcgcagtgtttccagaaaataaccctcaggtggtgagccacctgacggcgcttggc
gtcatctgcatcgacgatgtgaatcaactacaactgcacgagtga

DBGET integrated database retrieval system