KEGG   Vibrio vulnificus MO6-24/O: VVMO6_01863Help
Entry
VVMO6_01863       CDS       T01415                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00340  Histidine metabolism
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01230  Biosynthesis of amino acids
Module
vvm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    VVMO6_01863
Enzymes [BR:vvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     VVMO6_01863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV86885
Position
I:complement(1998027..1999322)
Genome map
AA seq 431 aa AA seqDB search
MRTVVWQSLSETQQDAILERPAITEGANITAAVAEVIAKVRAEGDAALFELTEKFDRVKP
ESIRVTEQEIEEASARLTAKMKQALEQAYANIAKFHNAQKPTPIKVETQPGVVCEQVTRP
IQKVGLYIPGGSAPLPSTVLMLGVPAQIAGCRKVVLCSPPPIADEILYVAKLCNIDEVYN
VGGGQAVAAMAYGTESVTKVDKIFGPGNAYVTEAKRQVSNDFRGAAIDMPAGPSEVLVIA
DETADADFIAADLLSQAEHGPDSQVVLVTPSVLIADQVTDAVQKQLKQLSRASIAEKALA
SSLIIIADSLTQAVSISNYYGPEHLIVQTKNPRELLPLLDNAGSIFLGDWSPESAGDYAS
GTNHVLPTYGYTRTYSSLGLADFSKRMTIQELSAEGLKTLAPTVVTMAEAEGLDAHKRAV
TIRVEKLNARG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagaacggttgtttggcaatctcttagtgagacgcaacaagacgctattttggaacgt
ccagcgataacagaaggtgcgaatattaccgctgcagtagcagaagtgattgcgaaagtc
agagcagaaggcgatgcggcgctgttcgaactgacggaaaagtttgatcgcgttaaacca
gaatcgattcgagtgactgaacaagaaatcgaggaggcttctgctcgcttaactgcaaaa
atgaagcaagcgcttgagcaggcttacgccaatatcgcgaagttccacaatgcccagaaa
ccgacaccaattaaagtcgaaacacaaccgggtgtggtgtgtgaacaagtcactcgcccg
atacaaaaagtgggtttatacattcctggtggcagtgcaccgctgccttcaacggtattg
atgttgggtgttcctgcgcaaatcgcgggttgccgtaaagtggttttatgttcaccacca
ccgattgccgatgaaattctctatgtggcaaagctttgtaatatagatgaagtttacaat
gttggtggtgggcaagcggtagcggcgatggcttatgggacagaaagtgtcactaaggtg
gataaaatatttggtcctggcaatgcgtatgtcacagaagcaaaacgccaagtgagcaat
gattttcgtggtgcagctattgatatgcccgcagggccatcagaagtgttggtgattgct
gatgaaactgcagatgccgattttatcgccgccgatttacttagccaagccgagcacgga
ccagactcgcaagtggttttagtgacgccatcagtattgattgcagatcaagtaacggat
gctgtgcagaaacagttgaagcaattatcgcgtgcctcaattgctgaaaaagcactagcg
tcgagcttgataattattgctgactccttgacccaagcggtttctatttcaaattattac
ggtccagagcatttaattgttcaaaccaaaaatcctcgagagttgttgccattgctggat
aacgcaggttccattttcttaggtgattggtcgcctgaatcggcgggcgattatgcgtca
ggaaccaaccacgtattgccgacgtatgggtacacccgtacgtattcaagtttaggtttg
gctgatttttcaaaacgcatgacgattcaagaactatcggctgaaggtttaaaaacactg
gcacctacggttgttacaatggcagaagcggaagggttggatgcacacaaacgtgcggtg
accattcgtgtcgaaaagctgaatgcacgtggataa

DBGET integrated database retrieval system