KEGG   Vibrio vulnificus MO6-24/O: VVMO6_01999Help
Entry
VVMO6_01999       CDS       T01415                                 

Definition
indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VVMO6_01999
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VVMO6_01999
Enzymes [BR:vvm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VVMO6_01999
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     VVMO6_01999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2151538..2152965
Genome map
AA seq 475 aa AA seqDB search
MTNSNEKLSEHVSLQEAQMAEVLAKIVRDKYQWVAERKHAQPLASFQATLTPSDRSFYQA
LQGQRTVFITECKKASPSKGLIREDFDLDYIASVYNHHADAISVLTDEKYFQGSFDFLPR
VRQQVRQPVLCKDFMVDSYQVYLARHYQADAILLMLSVLNDEQYQTLADVAHQLKMGVLT
EISNDEELERAVKLGAKVIGINNRNLRDLTTDLNRTKVLAPTLRRLAPEAIVISESGIYT
HQQVRDLAQYADGFLIGSSLMAEKNLELAVRKVTLGENKVCGLTHPEEAAKAYQAGAVFG
GLIFVEQSKRAVNIEQARLTMSGAPLNYVGVFQNHPVTLVAETANQLQLHAVQLHGNEEA
DYIAQLRKQLNESIEIWKAYGVTDQAPTLLTQDVDRHLFDAQVGQQSGGTGTTFDWALLD
DPSHIMLAGGLNPDNAQKAASLGCLGLDLNSGVEESPGKKDLTKLQQAFAAIRNY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacagcaacgaaaaactgtcagaacacgtttctctgcaggaagcacaaatggcg
gaagtcctagccaagatagtgcgcgataaataccagtgggtagccgagcgtaaacacgcg
caaccattggccagttttcaagccacattgacaccatcggatcgcagcttttaccaagcc
ttgcagggccaacgcacggtattcattaccgaatgtaagaaagcctccccatcgaaggga
ttgatccgtgaagatttcgacttggattacatcgcgtcggtgtacaaccaccacgcagat
gcgatttcggtactcaccgatgagaaatacttccaaggcagcttcgactttctgccccga
gtgcgtcagcaagtgcgccagcctgtgttgtgtaaagattttatggtcgatagctatcaa
gtttatctcgctcgtcactatcaagccgacgccattttattgatgttgtcagtcctcaat
gacgagcaatatcaaacactggcggatgttgcccaccagttgaaaatgggtgtgctgaca
gaaatcagtaatgacgaagagcttgagcgtgctgtgaagctgggggcgaaggtgattggc
attaacaaccgcaacttacgtgacctcaccaccgatttgaatcgcaccaaagtactcgcg
ccaactttgcgtcgcctagcaccagaagcgattgtgatctcggaatcgggcatttacacc
caccagcaagtgcgcgatctcgcccaatacgctgatggctttttgatcggtagctcactg
atggcagaaaaaaacctcgagctcgcggtacgtaaagtgacactgggtgaaaacaaagtc
tgtggtctcactcatccggaggaagccgccaaagcctatcaagctggcgctgtctttggt
ggtttgatttttgtagagcaatccaaacgtgctgtaaatatagagcaggcaagactgacg
atgagtggcgctccgctcaattatgttggcgtgttccaaaatcaccccgttaccttggtg
gccgaaaccgcaaaccagctgcaactgcatgcggtgcaattacatggcaacgaagaagcc
gattacatcgcacaactgcgcaagcaactcaacgaatcgattgagatttggaaagcctat
ggcgtgaccgaccaagcaccgactctacttactcaagatgttgatcgtcatcttttcgat
gctcaagtcggccaacaaagcggtggaacagggaccacgtttgattgggctctattggat
gatccaagccatatcatgttggcaggcggtctcaatccagacaacgcgcaaaaggcagca
agccttggatgtttaggactggatttaaactctggtgtcgaagaaagccctgggaaaaaa
gatctgacgaagctgcagcaagcgtttgcagccatccgaaattattga

DBGET integrated database retrieval system