KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02000Help
Entry
VVMO6_02000       CDS       T01415                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VVMO6_02000
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VVMO6_02000
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VVMO6_02000
Enzymes [BR:vvm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VVMO6_02000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2153041..2154231
Genome map
AA seq 396 aa AA seqDB search
MTKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPDFRSEFMGLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGATVIPVHSGSATLKDACNEALRDWSGSY
ETAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEETVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDENGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYDSITDDEALDAFQELARSEGIIPALESSHALAHALKM
ARNNPEKEQLLVVNLSGRGDKDIFTVHAILEEKGAI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactaagttaaatgcctactttggcgaatacggcggtcagtacgtacctcagattctg
gtacccgcattagagcagctcgagcaagcgttcattgacgcccaagaagacccagatttc
cgcagtgagtttatggggttactccaagaatacgcaggccgcccaaccgcactgacgctg
acgcgcaatctgaccaaaggcaccaaaaccaaactgtacctaaaacgtgaagatttgctg
cacggtggcgcgcacaaaaccaaccaagtacttggtcaagcactgttggctaagcgcatg
ggcaaaaacgagatcattgctgaaacgggcgcaggccaacatggcgttgccactgctctt
gcctgcgcactactgggcttgaagtgtcgcgtgtacatgggagcaaaagacgttgaacgc
caaagtccaaacgtgtttcgtatgaagttgatgggcgcgacggtgattccggtgcactca
ggttctgccacactgaaagacgcgtgtaatgaagcattgcgtgattggtcgggtagctat
gaaactgcccactacttattgggcactgccgcgggtccccaccctttcccaaccatcgta
cgtgagttccaacgtatgattggtgaagagacaaagaatcagatcctcgcacgcgaaggg
cgcctgcctgatgcagtgattgcttgtgttggtggcggctcaaacgccatcggtatgttc
gccgattttatcgaagaagaaacggttcgcctgattggtgttgaacctgcgggcaaaggc
attgataccgaccaacatggtgcgcccttaaaacatggcaaaactggcattttctttggt
atgaaagcgccactcatgcaagatgaaaacggccaagtcgaagagtcatactccgtttcc
gcaggtctcgatttcccatcagtgggtcctcaacacgctcaccttaatgccattggtcgc
gctgaatacgacagcatcaccgatgatgaagcgcttgatgcgttccaagagttggcaaga
agtgagggtattattcctgcgttagaatcgtctcacgctttggcacatgcgctgaaaatg
gcccgcaacaacccagagaaagagcagttgttggtcgttaacctatctggtcgaggtgac
aaagacatctttaccgttcatgccattttagaagaaaaaggagcaatctaa

DBGET integrated database retrieval system