KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02000Help
Entry
VVMO6_02000       CDS       T01415                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00260  Glycine, serine and threonine metabolism
vvm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01130  Biosynthesis of antibiotics
vvm01230  Biosynthesis of amino acids
Module
vvm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VVMO6_02000
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VVMO6_02000
Enzymes [BR:vvm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VVMO6_02000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV87022
Position
I:2153041..2154231
Genome map
AA seq 396 aa AA seqDB search
MTKLNAYFGEYGGQYVPQILVPALEQLEQAFIDAQEDPDFRSEFMGLLQEYAGRPTALTL
TRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMKLMGATVIPVHSGSATLKDACNEALRDWSGSY
ETAHYLLGTAAGPHPFPTIVREFQRMIGEETKNQILAREGRLPDAVIACVGGGSNAIGMF
ADFIEEETVRLIGVEPAGKGIDTDQHGAPLKHGKTGIFFGMKAPLMQDENGQVEESYSVS
AGLDFPSVGPQHAHLNAIGRAEYDSITDDEALDAFQELARSEGIIPALESSHALAHALKM
ARNNPEKEQLLVVNLSGRGDKDIFTVHAILEEKGAI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactaagttaaatgcctactttggcgaatacggcggtcagtacgtacctcagattctg
gtacccgcattagagcagctcgagcaagcgttcattgacgcccaagaagacccagatttc
cgcagtgagtttatggggttactccaagaatacgcaggccgcccaaccgcactgacgctg
acgcgcaatctgaccaaaggcaccaaaaccaaactgtacctaaaacgtgaagatttgctg
cacggtggcgcgcacaaaaccaaccaagtacttggtcaagcactgttggctaagcgcatg
ggcaaaaacgagatcattgctgaaacgggcgcaggccaacatggcgttgccactgctctt
gcctgcgcactactgggcttgaagtgtcgcgtgtacatgggagcaaaagacgttgaacgc
caaagtccaaacgtgtttcgtatgaagttgatgggcgcgacggtgattccggtgcactca
ggttctgccacactgaaagacgcgtgtaatgaagcattgcgtgattggtcgggtagctat
gaaactgcccactacttattgggcactgccgcgggtccccaccctttcccaaccatcgta
cgtgagttccaacgtatgattggtgaagagacaaagaatcagatcctcgcacgcgaaggg
cgcctgcctgatgcagtgattgcttgtgttggtggcggctcaaacgccatcggtatgttc
gccgattttatcgaagaagaaacggttcgcctgattggtgttgaacctgcgggcaaaggc
attgataccgaccaacatggtgcgcccttaaaacatggcaaaactggcattttctttggt
atgaaagcgccactcatgcaagatgaaaacggccaagtcgaagagtcatactccgtttcc
gcaggtctcgatttcccatcagtgggtcctcaacacgctcaccttaatgccattggtcgc
gctgaatacgacagcatcaccgatgatgaagcgcttgatgcgttccaagagttggcaaga
agtgagggtattattcctgcgttagaatcgtctcacgctttggcacatgcgctgaaaatg
gcccgcaacaacccagagaaagagcagttgttggtcgttaacctatctggtcgaggtgac
aaagacatctttaccgttcatgccattttagaagaaaaaggagcaatctaa

DBGET integrated database retrieval system