KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02001Help
Entry
VVMO6_02001       CDS       T01415                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00260  Glycine, serine and threonine metabolism
vvm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01130  Biosynthesis of antibiotics
vvm01230  Biosynthesis of amino acids
Module
vvm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VVMO6_02001
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VVMO6_02001
Enzymes [BR:vvm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VVMO6_02001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV87023
Position
I:2154231..2155037
Genome map
AA seq 268 aa AA seqDB search
MDRYQATFERLAAQKQGAFVPFVTVCDPNPELSLKIMDTLVKAGADALELGIPFSDPLAD
GPTIQGANIRALDSGATPDICFDLIGQIRAKYPDLPIGLLMYANLVYSRGIENFYQRCAQ
AGIDSVLIADVPTNESAEFVAAAEKFGVHPIFIAPPTASDETLKQVSQLGGGYTYLLSRA
GVTGAETKANMPVGDMLAKLEQFNAPPALLGFGISEPEQVKQAIDAGAAGAISGSAVVKI
IESHLNEPDAMLTALANFVSSMKSATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaccgttatcaagcgacatttgagcgcctcgccgcgcaaaaacaaggtgcctttgtt
ccttttgttaccgtgtgtgaccctaaccctgaactctcactcaagatcatggatacctta
gttaaagcgggtgccgatgctcttgaacttggcattccattttctgatccattggccgac
ggcccaacgatccaaggcgcaaatattcgcgcgctggattcaggcgcaacacctgatatc
tgttttgatttgatcggacaaatccgagctaaatacccagatctaccgattggcctgttg
atgtacgccaacttggtctattcacgtggtatcgagaatttctaccaacgttgcgctcaa
gcaggcattgattctgtgttgatcgccgatgtcccaacgaacgaaagtgcagagtttgtc
gcggcagccgaaaagtttggtgtacatccaatctttatcgcaccaccaacggccagtgat
gaaacactaaaacaggtttcacaactgggtggcggttatacctatcttctctctcgagcg
ggggtcacaggagctgaaacaaaagccaacatgcctgtgggtgatatgcttgcgaagcta
gaacaatttaatgcgccacctgcactgttgggctttggtatatcagagcctgaacaagtc
aaacaggctatcgatgcgggtgcggcaggtgccatttcaggctctgcagtggtcaaaatc
atcgaaagtcacctcaatgaacctgacgcgatgttaacggcactggcaaactttgtttcc
agcatgaagtctgcaacacaaaagtaa

DBGET integrated database retrieval system