KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02001Help
Entry
VVMO6_02001       CDS       T01415                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vvm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vvm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:vvm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2154231..2155037
Genome map
AA seq 268 aa AA seqDB search
MDRYQATFERLAAQKQGAFVPFVTVCDPNPELSLKIMDTLVKAGADALELGIPFSDPLAD
GPTIQGANIRALDSGATPDICFDLIGQIRAKYPDLPIGLLMYANLVYSRGIENFYQRCAQ
AGIDSVLIADVPTNESAEFVAAAEKFGVHPIFIAPPTASDETLKQVSQLGGGYTYLLSRA
GVTGAETKANMPVGDMLAKLEQFNAPPALLGFGISEPEQVKQAIDAGAAGAISGSAVVKI
IESHLNEPDAMLTALANFVSSMKSATQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaccgttatcaagcgacatttgagcgcctcgccgcgcaaaaacaaggtgcctttgtt
ccttttgttaccgtgtgtgaccctaaccctgaactctcactcaagatcatggatacctta
gttaaagcgggtgccgatgctcttgaacttggcattccattttctgatccattggccgac
ggcccaacgatccaaggcgcaaatattcgcgcgctggattcaggcgcaacacctgatatc
tgttttgatttgatcggacaaatccgagctaaatacccagatctaccgattggcctgttg
atgtacgccaacttggtctattcacgtggtatcgagaatttctaccaacgttgcgctcaa
gcaggcattgattctgtgttgatcgccgatgtcccaacgaacgaaagtgcagagtttgtc
gcggcagccgaaaagtttggtgtacatccaatctttatcgcaccaccaacggccagtgat
gaaacactaaaacaggtttcacaactgggtggcggttatacctatcttctctctcgagcg
ggggtcacaggagctgaaacaaaagccaacatgcctgtgggtgatatgcttgcgaagcta
gaacaatttaatgcgccacctgcactgttgggctttggtatatcagagcctgaacaagtc
aaacaggctatcgatgcgggtgcggcaggtgccatttcaggctctgcagtggtcaaaatc
atcgaaagtcacctcaatgaacctgacgcgatgttaacggcactggcaaactttgtttcc
agcatgaagtctgcaacacaaaagtaa

DBGET integrated database retrieval system