KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02043Help
Entry
VVMO6_02043       CDS       T01415                                 

Definition
alcohol dehydrogenase; acetaldehyde dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VVMO6_02043
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VVMO6_02043
   00620 Pyruvate metabolism
    VVMO6_02043
   00650 Butanoate metabolism
    VVMO6_02043
  Lipid metabolism
   00071 Fatty acid degradation
    VVMO6_02043
  Amino acid metabolism
   00350 Tyrosine metabolism
    VVMO6_02043
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VVMO6_02043
   00626 Naphthalene degradation
    VVMO6_02043
Enzymes [BR:vvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VVMO6_02043
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VVMO6_02043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2189639..2192314)
Genome map
AA seq 891 aa AA seqDB search
MPVTNMAELDAMIARVKKAQEEFATYSQEQVDAIFRAASLAANQARIPLAQMAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNDAAKLVLEAAVAAGAPKDIIGWIDQPSVELSNA
LMKHDDIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASILMSKTF
DNGVVCASEQAAIVVDAVYDEVKERFASHKAYVLSKAEAEKVRKVLLIDGALNAKIVGQP
AAAIAEMAGVKVPADTKVLVGEGLGKVSYDDAFAHEKLSPTLGLFRADDFEDAVAQAVTM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKLKTARILVNIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALSDLEGKKR
AFLVTDRFLFNNGYADDVVQLLKAQGMEVQTFFDVEADPTLSVVEKGAAAMQSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYELTPQMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGAKDPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKIGAEFHLPHGLANALLISNVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQAGDRTAQKIERLLAWLDELKGNLDIPMSIQAAGVAEADFLAKVDELAVEAFDDQC
TGANPRYPLIAELKEVLLASYYGKAFVEGETFEGTTVIKKKADQVAPKAKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaactaatatggctgaactagatgcgatgattgcacgcgttaagaaagcgcaa
gaagagttcgctacttactctcaagagcaagtagatgcaatcttccgtgcagcttctcta
gccgctaaccaagctcgtatcccgctagcacaaatggcggttgaagaatctggtatgggt
attgttgaagataaagtaatcaagaaccactttgcatctgagtttatctacaacaaatac
aaggacgaaaaaacgtgtggcatcctagaagaggatgacaacctaggtacgatgactatc
gctgaaccagtaggtatcatctgcggtatcgttccaaccactaacccaacttcgactgca
atcttcaaatcactgatctctttgaagactcgtaacggtatcatcttctcgccacaccca
cgtgcgaaaaactcgactaacgacgcagcgaaactggttctagaagcagcggtagcagct
ggcgcaccaaaagacatcatcggttggatcgaccagccatctgtagagctttctaacgcg
cttatgaagcacgatgacatcgcacttatccttgcaactggtggtccaggcatggttaaa
gctgcttactcttctggtaagccagcaatcggtgtaggtgcaggtaacgttcctgttgtt
atcgatgaaactgcggacatcaaacgtgcagttgcatctatcctaatgtctaagacgttc
gataacggcgtagtatgtgcttctgagcaagctgcaatcgttgttgacgcagtatacgat
gaagtgaaagagcgttttgcttctcacaaagcatacgtacttagcaaagctgaagcagaa
aaagtacgtaaagtactgctaatcgatggcgcactaaatgcgaaaatcgttggccagcca
gctgcagcaatcgctgaaatggcaggcgttaaagttcctgctgatactaaagttctcgtt
ggtgaaggcctaggcaaagtgtcttacgatgacgcatttgctcacgagaagctatctcca
actctaggtctattccgtgctgatgacttcgaagacgcagttgcacaagcagtaaccatg
gttgaaatcggcggtatcggtcacacatctggtctatacactaaccaagacgtaaacgca
gaccgtatccgttacttcggtgacaaactgaagactgcacgtatccttgtaaacatccca
actactcacggtggtatcggtgacctttacaactttaacgttgcaccatctctaactctt
ggttgtggttcatggggtggtaactctatctctgagaacgtaggtcctaagcacctaatc
aacaagaaaactgttgcgaagcgagctgaaaacatgttgtggcacaaactacctaagtca
atctacttccgtcgtggtagccttccaatcgcactaagcgacctagaaggtaagaaacgc
gcattcctagtaactgaccgtttcctattcaacaacggttacgcagatgacgtagtacaa
cttcttaaagctcaaggcatggaagttcaaacattctttgatgttgaagctgacccaacg
ctatctgttgtagagaaaggcgcagcggcaatgcaaagcttccagccagatgtgattcta
gcgctaggtggtggttcaccaatggatgctgcgaagatcatgtgggtaatgtacgagcac
ccagaaactcacttcgaagaacttgcaatgcgctttatggatatccgtaaacgtatctac
aagttccctaaaatgggtaagaaagctgagcttgtatgtatcactaccacttcaggtaca
ggttcagaagtaacaccattcgcggttgttactgacgacaagactggtgctaagtaccca
ctagcggattacgaattgactcctcaaatggcaatcgtagatgcgaacctagtgatgaac
atgcctaagtctctaaccgcattcggtggttacgatgcagtgactcacgctctagaagct
tacgtatctgttcttgcgaacgaatactcagatggtcaggctctacaagcacttaagatg
ctaaaagagtacctaccttcaagctacgcgaatggtgcaaaagacccaatcgctcgtgag
aaagtacacaacgcagcgaccatcgctggtatcgcattcgcgaacgcgttcctaggtgta
tgtcactctatggcgcacaagatcggtgcagagttccacctaccacacggtttggcgaac
gctctacttatctctaacgtggtacgttacaacgcgaacgataacccaactaagcaaact
gcgttctctcaatacgaccgtccacaagcacgtcgtcgttacgctgaagttgctgaccac
ctaggcctaagccaagctggtgaccgcactgctcagaagattgaacgtctactagcatgg
ttggatgagctaaaaggtaacctagacatcccaatgtctatccaagcggcaggtgttgct
gaagctgacttcttagcgaaagttgatgaactagcagtagaagcgttcgatgaccagtgt
actggtgcgaacccacgctacccactaattgctgagctaaaagaagttctactggcttct
tactacggtaaagctttcgttgaaggtgaaactttcgaaggtacgactgtaatcaagaag
aaagcagaccaagtagcgccaaaagcgaaaaaataa

DBGET integrated database retrieval system