KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02082Help
Entry
VVMO6_02082       CDS       T01415                                 

Definition
(GenBank) aldose 1-epimerase family protein YeaD
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00010  Glycolysis / Gluconeogenesis
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VVMO6_02082
Enzymes [BR:vvm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     VVMO6_02082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV87104
Position
I:2238127..2239011
Genome map
AA seq 294 aa AA seqDB search
MDLNSLPALTVLSDCVTIVEKDNVKIVRVIHEKATAGISLFGGHVVSYQPTGKADVIWMS
DKAVFDGKTALRGGIPVCWPWFGRIAAPAHGFARTSEWELVEHRENDNGVIVELALFPTE
ETHNLWPHMFDVRLIVEIGDELKVSLNILNIDDDAFTFSGALHTYLNVGDIEQTQTMGMG
SEYIDSLKAGELCNGGEVLQLTDTIDRVYTQPEKEIVVKDPVIERTLCIENQGHNCAVLW
NPWAQGAAGMADMSDDGYKTMLCVESTLHADSITQGKTLNPGESHQLITVLSAR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatcttaattcacttccggcgctgactgtcctgtctgattgcgtcaccattgttgaa
aaagacaatgtcaaaattgttcgtgtgattcacgagaaagcaaccgcaggtatctctttg
tttggcggccatgttgtctcctatcagccgacgggtaaagctgacgtcatttggatgagt
gacaaggcagtatttgatggtaaaactgcgctgcgcggcggcattccggtttgttggcct
tggtttggccgcattgcagcacctgcacacggctttgctcgcacttcagagtgggagctg
gttgaacaccgcgaaaacgacaacggtgtgatcgttgaactcgccttgttcccgacagaa
gaaacgcacaatctctggcctcatatgtttgatgttcgcctaatcgtcgagatcggcgat
gaactgaaagtgtcactcaacattcttaatattgatgacgacgcattcactttctcgggc
gctctgcatacctatttgaacgtcggtgatattgaacaaactcaaactatgggcatgggc
tctgagtacattgacagtttgaaagcgggcgaactatgcaatggcggtgaagttttacaa
ttgaccgacacgatcgatcgtgtctacacacaacctgagaaagagattgtggttaaagac
ccagtcattgaacgtactctgtgcattgaaaaccaaggtcacaactgcgccgtgctctgg
aacccttgggctcaaggtgccgctggcatggcggacatgagcgatgacggttacaaaacc
atgctgtgtgtagaatccactctgcatgcagacagtattactcagggcaaaacgctcaac
cctggcgaaagtcaccagttaatcactgtgctttctgcgcgctaa

DBGET integrated database retrieval system