KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02193Help
Entry
VVMO6_02193       CDS       T01415                                 

Definition
(GenBank) succinyl-CoA ligase [ADP-forming] beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00020  Citrate cycle (TCA cycle)
vvm00640  Propanoate metabolism
vvm00660  C5-Branched dibasic acid metabolism
vvm01100  Metabolic pathways
vvm01110  Biosynthesis of secondary metabolites
vvm01120  Microbial metabolism in diverse environments
vvm01130  Biosynthesis of antibiotics
vvm01200  Carbon metabolism
Module
vvm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vvm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VVMO6_02193
   00640 Propanoate metabolism
    VVMO6_02193
   00660 C5-Branched dibasic acid metabolism
    VVMO6_02193
Enzymes [BR:vvm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VVMO6_02193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV87215
Position
I:complement(2361470..2362636)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTYQTDANGQPVTKILVEEASNIANELYLGAVVDRATRK
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLQGDQIKQFVKI
FMGLGEMFTQYDLALLEINPLVITGEGNLLCLDGKINIDSNALYRQPKLREMHDPSQEDK
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVSVPVVVRLEGTNADLGRKV
LAESGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagccaaacagctgtttgcagaattcggtttgccggtacca
gaaggttatgcttgtgatacacctcaagaagcatttgaagctgctggccgcattagcacc
gcgaagaaagttgtaaaatgtcaggttcacgcaggtggccgcggtaaagcgggtggcgta
gagcttcacgatacgaaagaaggcgtgaaagaatttgcacaaaaatggcttggcaaaaac
ctggtaacttatcagacagatgcgaatggtcagccagtaacaaaaattttggttgaagaa
gcgtccaatattgccaacgagctatacttgggtgctgtcgttgaccgtgcaacacgtaaa
gtcgttttcatggcctcaactgaaggcggtgtggaaatcgaaaaagttgcagaagaaaca
cctgaactgattcacaaagcggctattgatccactggtaggccctcaggcttatcaaggt
cgtgagcttgcatttaaacttggtcttcaaggcgatcaaattaagcagtttgtgaaaatc
ttcatgggtttgggtgaaatgttcactcaatacgatctcgctcttcttgaaatcaaccca
cttgtgattactggtgaaggcaacctactttgtctagatggtaagatcaacatcgactca
aatgcgctttaccgccaacctaaactgcgtgaaatgcacgatccttcgcaagaagataag
cgtgaagctcatgcggcgcagtgggaactgaactacgtagcacttgacggtaacgtcggc
tgtatggtgaacggtgcaggccttgcaatgggtactatggacatcgtaaacctacacggt
ggcaaaccagccaacttcttggatgtaggtggcggcgcgacaaaagagcgtgtagcagag
gcattcaagatcatcctttctgatgacaatgtaaaagccgttttggtgaacatctttggt
ggtattgttcgttgtgacatgatcgcagaaggtatcatcggcgcggtaaaagaagttggt
gtaagcgtacccgttgttgtacgccttgaaggtactaacgcggatcttggccgcaaagta
ctggcagagtcaggtttggatatcattgcagcagaatcactaacagatgctgctcagaaa
gtagttgctgcggcggagggcaaataa

DBGET integrated database retrieval system