KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02193Help
Entry
VVMO6_02193       CDS       T01415                                 

Definition
(RefSeq) succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVMO6_02193
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VVMO6_02193
   00640 Propanoate metabolism
    VVMO6_02193
   00660 C5-Branched dibasic acid metabolism
    VVMO6_02193
Enzymes [BR:vvm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VVMO6_02193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I:complement(2361470..2362636)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEFGLPVPEGYACDTPQEAFEAAGRISTAKKVVKCQVHAGGRGKAGGV
ELHDTKEGVKEFAQKWLGKNLVTYQTDANGQPVTKILVEEASNIANELYLGAVVDRATRK
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQAYQGRELAFKLGLQGDQIKQFVKI
FMGLGEMFTQYDLALLEINPLVITGEGNLLCLDGKINIDSNALYRQPKLREMHDPSQEDK
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVSVPVVVRLEGTNADLGRKV
LAESGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagccaaacagctgtttgcagaattcggtttgccggtacca
gaaggttatgcttgtgatacacctcaagaagcatttgaagctgctggccgcattagcacc
gcgaagaaagttgtaaaatgtcaggttcacgcaggtggccgcggtaaagcgggtggcgta
gagcttcacgatacgaaagaaggcgtgaaagaatttgcacaaaaatggcttggcaaaaac
ctggtaacttatcagacagatgcgaatggtcagccagtaacaaaaattttggttgaagaa
gcgtccaatattgccaacgagctatacttgggtgctgtcgttgaccgtgcaacacgtaaa
gtcgttttcatggcctcaactgaaggcggtgtggaaatcgaaaaagttgcagaagaaaca
cctgaactgattcacaaagcggctattgatccactggtaggccctcaggcttatcaaggt
cgtgagcttgcatttaaacttggtcttcaaggcgatcaaattaagcagtttgtgaaaatc
ttcatgggtttgggtgaaatgttcactcaatacgatctcgctcttcttgaaatcaaccca
cttgtgattactggtgaaggcaacctactttgtctagatggtaagatcaacatcgactca
aatgcgctttaccgccaacctaaactgcgtgaaatgcacgatccttcgcaagaagataag
cgtgaagctcatgcggcgcagtgggaactgaactacgtagcacttgacggtaacgtcggc
tgtatggtgaacggtgcaggccttgcaatgggtactatggacatcgtaaacctacacggt
ggcaaaccagccaacttcttggatgtaggtggcggcgcgacaaaagagcgtgtagcagag
gcattcaagatcatcctttctgatgacaatgtaaaagccgttttggtgaacatctttggt
ggtattgttcgttgtgacatgatcgcagaaggtatcatcggcgcggtaaaagaagttggt
gtaagcgtacccgttgttgtacgccttgaaggtactaacgcggatcttggccgcaaagta
ctggcagagtcaggtttggatatcattgcagcagaatcactaacagatgctgctcagaaa
gtagttgctgcggcggagggcaaataa

DBGET integrated database retrieval system