KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02194Help
Entry
VVMO6_02194       CDS       T01415                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVMO6_02194
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VVMO6_02194
  Amino acid metabolism
   00310 Lysine degradation
    VVMO6_02194
Enzymes [BR:vvm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VVMO6_02194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2362827..2364035)
Genome map
AA seq 402 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKPGDRVERDEVLVDIETDKVVLEVPASEAGILEAIV
EEEGATVLSKQLIGRIKLAAVAGEPTADTTEESEPSPDKRHTASLSEESNDALSPAVRRL
LAEHSLEASQVKGTGVGGRITREDIEAHLAAAKQAPAVAEAPAAVAPVAARSEKRVPMTR
LRKTVANRLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDQFEARHGIRLGFMSFYVKAVT
EALKRYPEINASIDGDDIVYHNYFDISMAVSTPRGLVTPVLKDCDTLGFADVEKGIKELA
IKGRDGKLTVDELIGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTVKELLEDPARLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattctggttccagatttacctgaatcagtggccgatgcaacagttgca
acttggcacaagaaaccaggcgacagagttgagcgcgatgaagtactggttgatattgaa
acagacaaagtagtgttagaagtaccggcttcagaagcgggtattctagaagcgatcgtt
gaagaagaaggtgcgacagtgctttcgaagcaactgattggtcgcattaaattggcggct
gtcgcgggtgaacctacggctgatacgacggaagagtcagagccatctccagataagcgt
catacagcaagcttatcagaagagagcaatgatgcccttagtccagcggtgcgtcgcctt
ctcgcagagcatagcttggaagcaagccaagtaaaaggtacgggtgttggtggccgtatt
acacgtgaagatatcgaagcgcaccttgccgcggcaaaacaagctcctgcagttgcagaa
gctcctgctgcagttgcaccggttgctgctcgcagtgaaaaacgtgttccaatgacacgt
ctacgcaaaacagtggctaaccgtttgctagaagcgaaaaacagcacggcgatgttgacg
acgtttaacgaagttaacatgaagccaatcatggatcttcgtaagcagtatggtgatcag
tttgaagcgcgtcatggtattcgtcttggcttcatgtctttctacgtgaaagcggtgact
gaagcactgaagcgttatcctgaaatcaatgcatcgatcgatggtgatgacattgtttac
cacaactattttgacatcagtatggcggtttctacgccacgtggtctagtgactccagtc
ctaaaagactgcgacacgctaggttttgcggatgttgaaaagggtatcaaagagctcgcc
atcaaaggtcgtgacggaaaactaaccgttgacgagctaattggcggcaactttaccatc
acgaatggtggtgtgtttggttcattgatgtcgactccaatcatcaacccaccacaatct
gcgattttgggtatgcataagattcaagatcgtccgatggcggtagatggcaaagttgaa
attctgccaatgatgtacctagcactgtcttatgaccaccgcttgattgatggtcgcgag
tcggttggcttcctagtgaccgtgaaagagttactggaagatccagcacgtctgttgtta
gacgtttaa

DBGET integrated database retrieval system