KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02198Help
Entry
VVMO6_02198       CDS       T01415                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VVMO6_02198
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VVMO6_02198
   00650 Butanoate metabolism
    VVMO6_02198
  Energy metabolism
   00190 Oxidative phosphorylation
    VVMO6_02198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2369482..2369826)
Genome map
AA seq 114 aa AA seqDB search
MVKHVSSVGRNGVHDFLLIRATAIIMTLYTIYLVSFCAFTDINYASWTQFFGGTFTKVFT
MLALASVLIHAWIGLWQVLTDYIKCAKLRGGLQLGVIALLFGYFFSGLFVLWGA
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacacgtttcctctgttggccgtaacggtgtgcacgatttcttgttgattcgt
gcaacggccatcatcatgactctttacaccatttatcttgttagcttctgtgcgttcaca
gatatcaattatgcatcctggactcagttttttggtggcacttttactaaagtcttcacc
atgcttgctctcgcttctgtcctgattcatgcctggattggattatggcaagtgctgact
gactacatcaagtgcgccaaattgcgtggtggtttacaacttggtgtgatcgcactgctg
ttcgggtatttcttctctggtctgtttgtattgtggggtgcataa

DBGET integrated database retrieval system