KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02219Help
Entry
VVMO6_02219       CDS       T01415                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VVMO6_02219
Enzymes [BR:vvm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     VVMO6_02219
Peptidases [BR:vvm01002]
 Cysteine Peptidases
  Family C44
   VVMO6_02219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2391480..2393144
Genome map
AA seq 554 aa AA seqDB search
MCSVFGILDIKSDAAALRPIALEMSKKLRHRGPDWSGIYASDRAILAHERLAIVGLNSGA
QPLYSPDKKLILAVNGEIYNHKEIRARYEGKYDFQTDSDCEVILALYQEMGADLLEELNG
IFAFVLYDEEKDQYLVGRDHIGIIPLYQGYDEHGNYYVASEMKALVPVCKTISEFPPGSY
YSSTDAGPQRYYIRDWNEYAAVQGNTSSKEELTAALEAAVKRQLMTDVPYGVLLSGGLDS
SITSAVAKRYAAMRIEDDEQTEAWWPQLHSFAIGLDGAPDLKAAREVAAKIGTVHHEMTY
TIQEGLDAIRDVIYHIETYDVTTIRASTPMYLMGRKIKAMGIKMVLSGEGADEIFGGYLY
FHKAPNAQEFHEETVRKLLALNMFDCARANKSLAAWGVEGRVPFLDKEFIDVAMRLNPAD
KMCGNGKMEKHILRECFEHYLPDSIAWRQKEQFSDGVGYGWIDTLKAVAEEKVTDQQMEA
AKFRFPYNTPTTKEGYVYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKNCID
PSGRAVKAVHNEAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcagtatttggcattttagacattaaaagcgacgcagcggcgcttcgccctatc
gctttagagatgtcgaaaaaacttcgtcaccgtggcccagactggtccgggatctacgca
tcagatcgagcaattcttgctcatgagcgtcttgcgatcgtaggtcttaacagcggcgca
cagcctctttacagcccagataaaaaactcatccttgccgttaacggtgaaatctacaac
cacaaagaaattcgtgctcgttacgaaggcaaatatgatttccaaacagattctgattgt
gaagttattctcgctctctaccaagaaatgggtgccgatctcctagaagaattaaacggt
atcttcgcttttgttctttacgatgaagagaaagatcagtacctagttggacgtgaccac
attggtatcatcccgctttaccaaggttatgatgagcacggcaactactatgtcgcttca
gaaatgaaagcgttggttcccgtttgcaaaaccatcagtgaatttcctccaggtagctac
tacagctcaaccgatgcaggtcctcaacgttactacattcgcgactggaatgaatacgca
gcggtacagggcaacaccagcagcaaagaggaactaacagcagcgcttgaagcggcggtg
aaacgtcagttgatgacagatgtgccttacggtgtattactgtcgggtggacttgattct
tctattacctctgcggttgctaaacgttatgccgcaatgcgtattgaagacgacgaacaa
actgaagcctggtggccacagcttcactcatttgctattggtcttgacggcgctcctgat
ctgaaagcagcccgtgaagtggcggcgaaaattggcacagtgcaccatgaaatgacgtac
accattcaagaaggcttggacgcaattcgtgatgtgatttaccacatcgaaacatacgat
gtcacgaccatccgcgcgtcaacaccaatgtacttgatgggacgtaagatcaaagccatg
ggcatcaagatggtactttctggtgaaggggctgacgagatttttggtggctacctctac
ttccacaaagcacctaacgcacaagagttccacgaagagacagtacgtaaactgcttgcg
ctcaacatgtttgactgtgctcgcgcaaacaaatcgctggcggcttggggggttgaaggc
cgagtgccattcttggataaagagtttatcgatgttgcaatgcgcttgaaccctgcggac
aaaatgtgtggcaacggcaaaatggagaaacacattcttcgtgagtgctttgagcactac
ctaccagactctattgcttggcgtcaaaaagagcagttctctgatggcgtgggttatggc
tggatcgacacactcaaagcagtggcagaagagaaagtaaccgatcaacagatggaagcc
gcaaaattccgcttcccatacaacacgccaacaacaaaagaaggctatgtataccgcgaa
attttcgaagagttgttcccactgccatcggctgcagaatgtgtccctggcggtccatca
gtggcttgttcgtccgctaaagcgattgaatgggacgaatcctttaaaaactgtattgac
ccatcaggtcgagcagtgaaagcggtacataacgaagcgtattaa

DBGET integrated database retrieval system