KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02363Help
Entry
VVMO6_02363       CDS       T01415                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vvm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VVMO6_02363
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VVMO6_02363
Enzymes [BR:vvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VVMO6_02363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2536727..2537866)
Genome map
AA seq 379 aa AA seqDB search
MTTNQQSVAASQPKTIVVKLGTSVLTGGTLALDRAHMVELARQCAELKKQGHSVVVVSSG
AIAAGREHLGYPALPNAMASKQLLAAVGQSQLIQTWESLFALYGIKIGQMLLTRADLEDR
ERFLNARDTINALVDNGIIPVVNENDAVATSEIKVGDNDNLSALVGILCGADKLLLLTDQ
KGLYTADPRKDPNAELIKEVKVIDDTLRKIAGGSGTTLGTGGMATKLQAADIARRAGIEV
IIAAGRGQNVIFDALSPAPQGTRFLPCEEALENRKRWILAGPAASGDIVIDQGAVKAVVE
KGSSLLAKGVTKVLGEFSRGEVVRVTDAQGHLVARGIASYSNQDMAKIAGKHSKDIISIL
GYDYGSEVIHRDDMVVIQE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaatcaacaaagcgtcgcagcttctcaaccaaaaactattgttgtgaagctt
ggaaccagtgtattgaccggtggtacattagcgttagatcgcgctcatatggttgagctt
gcgcgccaatgtgcagagttaaaaaaacaaggccactctgtggtggtcgtctcgtcaggc
gcgattgccgctggacgtgagcacttaggttaccccgcgctgcccaatgcgatggcaagc
aaacagttgcttgctgcggttgggcaaagtcagttgattcaaacttgggaatcgttattt
gcactgtatggcatcaaaattggccaaatgttgctcactcgagcggatctcgaagatcgc
gaacgttttctcaatgctcgagatacgattaacgcgttagtggataacggcattatccct
gtcgttaatgaaaatgacgccgtcgccacgagcgaaatcaaagtgggtgacaacgacaac
ctctctgcgttggtgggcattttatgtggtgctgataaactactgttgctgacagaccaa
aaaggcttgtataccgccgatccgcgtaaagatcccaatgctgagctgatcaaagaagtt
aaagtcattgacgatactttgcgtaaaattgctggtggcagcggtacaacattaggtact
ggtgggatggcaacaaagctccaagctgcggacattgcgcgtcgtgctggcattgaggtc
atcattgcggcaggccgtggtcaaaatgtcatttttgatgcgttgagcccagcccctcaa
ggaacccgtttcttgccttgtgaagaggcgttggaaaaccgcaagcgttggattctcgct
ggccctgcggcctctggtgatattgtgattgaccaaggtgcggtgaaagccgtggtcgaa
aaaggcagcagtttgttggcgaaaggggtgaccaaagtacttggcgagttttctcgtggt
gaagtggtccgtgtaacggatgcacaaggccatttggttgcgagaggtattgcgagttat
tccaaccaagatatggcgaaaattgccggtaagcacagcaaagacattatttcgattctg
ggctatgactatggttcagaagtgattcaccgtgacgacatggttgtcattcaagaatag

DBGET integrated database retrieval system